KEGG   Geobacillus genomosp. 3: M493_14435Help
Entry
M493_14435        CDS       T02798                                 

Definition
(GenBank) acyl--CoA ligase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
gjf  Geobacillus genomosp. 3
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gjf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M493_14435
   00620 Pyruvate metabolism
    M493_14435
   00640 Propanoate metabolism
    M493_14435
  Energy metabolism
   00680 Methane metabolism
    M493_14435
Enzymes [BR:gjf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     M493_14435
Lipid biosynthesis proteins [BR:gjf01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   M493_14435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2698329..2699924)
Genome map
AA seq 531 aa AA seqDB search
MRREELIAPERYNLTSEMERHATADPDRIALKWENEQGETREITYGRLMARANQIGNAFL
SRGLQKGDKVLVMVPRLIEAYEVYVGALKAGLVVIPSSEMLRTKDLQYRLFHGEVKAIVA
YEPYLGEFAPIDGIDQLLKFSIGEHVHDGWLPLEACMAKESEVLEAADTSRDDMAFLSYT
SGTTGNPKGVVHCHGWAYAHLRTAAKNWLCIEEGDLVWATAGPGWQKWIWSPFLSVLGSG
ATGFVYYGRFEPETYLRLLEKYQINVLCCTPTEYRLMAKVPDIGRYDLSPLHSAVSAGEP
LNREVIDTFAKHFGIEVRDGYGQTENTLLVGVMKGMEIKPGSMGKPTPGNRVEIIDENGE
PCPPGQVGDIAVHVETPALFKHYYKDPERTAMQFRGDYYITGDKARKDEDGYFWFEGRGD
DIIISSGYTIGPFEVEDALVKHPAVKECAVVASPDEVRGHVVKAFVVLREGIDQTDPSLI
PALQEHVKQLTAPYKYPRKIEFVNDLPKTVSGKIRRVELREREARLFGRSS
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgggaagaattgatcgcgcctgagcggtacaatttaacatcggaaatggaaaga
cacgcaacggctgatccggatcggatcgcgttaaaatgggaaaacgagcaaggggaaacg
cgggagattacatacggccgtctgatggcgcgcgccaatcaaattggaaacgctttctta
tcgcgcggtcttcagaaaggagacaaagtgcttgtcatggtgccgcgcctcattgaggca
tatgaagtgtatgtaggggcgctcaaagccgggctggttgtcattccgagctcggagatg
ctgcggacaaaagatttgcaataccggctgttccacggggaagtaaaggcgatcgtcgcc
tacgaaccgtatctcggcgagttcgctccgatcgatggcatcgatcaactgctcaaattt
tcgattggcgaacacgttcatgacggctggctgccgcttgaagcgtgcatggcaaaggaa
agcgaggtgcttgaagcggcagacacgtcgcgcgatgatatggcgtttttatcgtacaca
tccggcacgaccggcaatccgaaaggggttgtgcattgccatggctgggcgtacgcccat
ttgcgcacagcggcgaaaaactggctgtgcattgaagagggcgatctcgtctgggcgacg
gccggaccgggatggcaaaaatggatttggagtccgtttttgtcggtgcttggctcaggg
gcgaccggctttgtctattacggccgttttgagccggaaacatatttgcggctgctcgaa
aaatatcaaatcaatgtgctttgctgcacgccgaccgagtaccgtctgatggcgaaagtg
ccggacatcggccgctacgatttgtcccctctccatagcgccgtttcagccggtgagccg
ctcaaccgcgaagtgatcgacacgtttgccaaacatttcggcatcgaagtgcgagacggc
tacgggcagacggaaaatacgctgctggtcggcgtcatgaaaggaatggagatcaagccg
ggctcgatggggaaaccgacgccgggcaaccgcgtcgagattatcgatgaaaacggtgag
ccgtgcccgccgggacaagtcggcgatatcgccgtccatgtcgaaacgccggcgttgttt
aaacattactacaaagacccggagcggacagcgatgcagttccgcggcgattactacatc
accggcgacaaggcgcgcaaagacgaagacggctatttttggtttgaagggcgcggcgat
gacatcatcatcagttccgggtatacgatcggtccgtttgaagtcgaagacgccctcgtc
aaacatccggcggtgaaagaatgcgcggttgtcgccagcccggatgaagtgcgcggccat
gtcgtcaaggcgttcgtcgtcttgcgcgaagggatcgaccaaactgatccgtccctcatc
ccggcgttgcaagaacatgtcaaacagttgaccgccccatacaagtatccgcgcaaaatc
gaatttgtcaacgacttgccgaaaacggtgtccggcaaaatccgccgcgtcgagctgcgc
gagcgggaagcgcgcctcttcggccggtcgtcataa

DBGET integrated database retrieval system