KEGG   Geobacillus kaustophilus: GK1023Help
Entry
GK1023            CDS       T00217                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase complex E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
gka  Geobacillus kaustophilus
Pathway
gka00020  Citrate cycle (TCA cycle)
gka00310  Lysine degradation
gka00380  Tryptophan metabolism
gka01100  Metabolic pathways
gka01110  Biosynthesis of secondary metabolites
gka01120  Microbial metabolism in diverse environments
gka01130  Biosynthesis of antibiotics
gka01200  Carbon metabolism
Module
gka_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gka_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gka00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GK1023
  Amino acid metabolism
   00310 Lysine degradation
    GK1023
   00380 Tryptophan metabolism
    GK1023
Enzymes [BR:gka01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     GK1023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: BAD75308
UniProt: Q5L172
LinkDB All DBs
Position
1048979..1051831
Genome map
AA seq 950 aa AA seqDB search
MAKQTNYAQPWSQFYGPNLGYVIEMYEQYLDDPNSIDPELKQLFEQWGAPVLEEPVSPAD
DETAKTHQTFRLPETPTIFSKLVAAVKLADSIRHYGHLVADTNPLVKKEKKLRRLELDEY
DLTEEDLKRIPVAFLCPHAPAHVKNGWDAILHLRKIYTDKIAFEFSQVHNLEERNWLIQQ
IESGAYYPSLANKERVALLRRLTEVEGFEKFIHRTYVGQKRFSIEGLDSMVPLLDELVRQ
AIEHEIDAVNIGMAHRGRLNVLAHVLGKPYEMIFAEFQHAESKNFIPSEGSVAITYGWTG
DVKYHLGAARRLRNQSAHTMRITLANNPSHLEVVNPVVLGYTRAAQEDRTKPGVPVQNTD
ASFAILIHGDAAFPGQGIVAETLNLSQLRGYTTGGTIHIIANNMIGFTTESYDSRSTTYA
SDMAKGFEVPIVHVNADDPEACLAAACLAFAYRQRFKKDFVIDLIGYRRFGHNEMDEPMA
TNPTMYAIINQHPTVRKLYAQKLMEKGIITEREVDEMEQEVAERLKIAYERVPKNEDELD
FIMDPPKPVVDRLPEVKTSVAKDVLHRVNEELLQFPDGFNVFNKLERILKRRSGVFAQNG
KVDWAHAEILAFATILQDGVPIRLTGQDSQRGTFAQRHLVLHDVKTGEEYVPLHHISGAK
ASFVVYNSPLTEAAVLGYEYGYNVYAPETLVLWEAQFGDFANMAQVMFDQFISSGRAKWG
QKSGLVMLLPHGYEGQGPEHSSGRVERFLQLAAENNWTVANLSTAAQYFHILRRQAALLT
REEVRPLIIMTPKSLLRHPLAASDAEVFVDGAFSPVLEQPGLGADAGKVERIVFGTGKLM
IDLAEQIGKMESLDWLHIVRIEELYPFPEEAVKDIIARYPNVKELVWVQEEPKNMGAWLY
MEPRLRALAPEGVDVSYIGRRRRASPAEGDPVVHRKEQERIIRCALTKHE
NT seq 2853 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacagacgaactacgctcaaccgtggagccagttttacgggccgaacctcggt
tatgtcatcgaaatgtacgaacagtatctcgatgaccctaacagcatcgacccggaactg
aaacaattgttcgaacagtggggggcgccggtcttggaagaaccggtttctcctgcggat
gacgaaacagccaaaacgcatcaaacgttccggctgccggagacgccgacgattttcagc
aagcttgtcgctgccgtcaagctggcggacagcattcgccattatggccatctggttgcc
gatacgaatccgcttgtcaaaaaggagaaaaagctgcgccgcttggagcttgacgaatac
gacttaaccgaagaggacttaaagcgcattccggtcgcgtttctttgcccgcacgctccg
gcgcatgtcaaaaacggatgggatgccatcttgcatttgcgcaaaatttacacggacaaa
atcgcgttcgaattctcgcaagtacataatctcgaagagaggaactggctcattcagcaa
atcgagtccggagcgtattacccgagcttggcgaacaaagagcgggtcgctttgttgcgc
cgcctgacggaagtggaagggtttgaaaagttcatccaccggacgtatgtcgggcaaaaa
cggttttcgatcgaagggcttgattccatggtgccgcttttggatgagctcgtccgccaa
gcgatcgaacatgaaatcgacgctgtcaacatcggcatggcgcaccgcggccggctgaat
gtgcttgcccatgtgctcggcaagccgtacgaaatgattttcgccgagtttcagcatgcg
gaaagcaaaaatttcattccgtctgaagggtcagtggcgatcacgtacgggtggacgggc
gatgtcaaataccacttaggggcggcgcgccgccttcgcaatcaaagcgcgcatacgatg
aggattacgctcgctaacaacccaagccatctcgaagtggtcaatccggttgtgcttggc
tacacgcgcgccgcgcaagaagatcggacaaaaccaggagtgccggtgcaaaatactgat
gcgtcgtttgccatcttgattcacggcgatgccgcgttcccgggacaagggatcgtcgcg
gaaacgctcaacttaagccagctgcgcggctatacgaccggcgggacgatccatatcatc
gccaataacatgatcggctttacgacggaaagctacgattcacgctcgacgacgtatgct
tccgatatggcgaaagggtttgaggtgccgattgtgcacgtcaatgccgacgatccggag
gcttgtttggcggccgcatgcttggcgtttgcctaccgccagcggtttaaaaaagacttt
gtcattgacctaatcggttaccgccgtttcggtcataatgaaatggatgaaccgatggcg
acgaatccgacgatgtacgcgatcatcaaccaacatccgactgtgcgcaagctgtatgcg
caaaaattgatggaaaaagggatcatcaccgagcgggaagtcgacgaaatggagcaagag
gtggcggaacggctgaaaatcgcctacgagcgggtgccgaaaaacgaagacgagcttgat
ttcatcatggatccgcccaaaccggtcgtcgatcggctaccggaagtgaaaacaagcgtg
gcgaaagacgtgctccatcgtgtgaacgaagaattgctgcagtttccggatggattcaac
gtctttaacaagcttgagcgcattttaaaacggcgaagcggcgtgtttgcgcaaaacggc
aaagtcgattgggcgcacgcggaaattttggcgttcgccacgattttgcaagacggggtg
ccgatccgtctgactggtcaagattcgcagcgcggcacgttcgcacagcgccatttggtg
ctccatgacgtgaaaaccggagaagagtatgtgccgcttcaccacatcagcggcgccaaa
gcgtcgtttgtcgtgtacaacagcccgctgacggaagccgccgtgctcggctatgaatac
ggctacaacgtttacgcgccggagacgctcgtgctttgggaagcgcaatttggcgacttc
gccaacatggcgcaagtgatgtttgatcaattcatttcatccggccgggcgaaatggggg
caaaaatctgggcttgtcatgctcttgccgcacggctacgaagggcagggcccggaacat
tcaagcggccgcgtcgagcgctttttgcagctggcggcggaaaacaactggacggtcgcc
aacttatcgacggccgcgcaatatttccatattttgcggcggcaggcggcgctgttgaca
agggaagaagttcgcccgctcatcattatgacgccaaaaagcttgctccgccatccgctg
gcagcgtccgatgcggaagtgttcgttgacggcgcgttctcgccggtgctcgaacagccg
ggattgggcgctgacgctggcaaagtggagcgcatcgtgtttggcaccggaaaattgatg
atcgatttggcggaacaaatcggcaaaatggaaagtcttgactggctgcatatcgtgcgc
attgaagagctgtatccgttcccggaagaagcggtgaaagacatcatcgcccgctatccg
aacgtcaaagagctcgtctgggtgcaagaagaaccgaaaaacatgggggcatggctgtat
atggaaccgcgcctgcgggcgttggctccagagggtgtcgatgtcagttacattgggcgg
cgccggcgggccagcccggcggaaggcgatccggtcgtccaccgaaaagagcaagagcgc
atcatccgctgtgcattgacgaagcatgaatga

DBGET integrated database retrieval system