KEGG   Geobacillus kaustophilus: GK2838Help
Entry
GK2838            CDS       T00217                                 

Definition
(GenBank) hypothetical protein
Organism
gka  Geobacillus kaustophilus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M4_C Peptidase_M4
Motif
Other DBs
NCBI-ProteinID: BAD77123
UniProt: Q5KW13
LinkDB All DBs
Position
complement(2865080..2865943)
Genome map
AA seq 287 aa AA seqDB search
MQDNTRGSGIFTYDGRNRTVLPGSLWADVDNQFFASYDAAAVDAHYYAGVVYDYYKNVHG
RLSYDGSNAAIRSTVHYGRGYNNAFWNGSQMVYGDGDGQTFLPFSGGIDVVGHELTHAVT
DYTAGLVYQNESGAINEAMSDIFGTLVEFYANRNPDWEIGEDIYTPGIAGDALRSMSDPA
KYGDPDHYSKRYTGTQDNGGVHTNSGIINKAAYLLSQGGVHYGVSVTGIGRDKMGKIFYR
ALVYYLTPTSNFSQLRAACVQAAADLYGSTSQEVNSVKQAFNAVGVY
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
ttgcaagacaatacgcgcggcagcggcatttttacgtatgacggacgaaaccgcaccgtt
ttgcccggcagcttatgggccgatgtcgacaaccaatttttcgccagctatgacgcggcg
gccgtggacgcccattattacgccggtgtcgtgtatgattactacaaaaatgtgcacggc
cggctgagctatgacggcagcaacgccgccatccgttcgaccgtccattatggccgtggc
tacaacaacgcgttttggaacggttcgcaaatggtgtacggcgatggcgacggacagacg
tttttgccgttttccggcggcattgacgtcgtggggcatgagttgacccatgcggtgacg
gattatacggccgggcttgtttaccaaaacgaatccggcgccatcaatgaagcgatgtcc
gatattttcggcacgctcgtggagttctacgccaaccgcaacccggactgggagatcggc
gaagacatttacacgccgggaattgccggcgacgcgcttcgctccatgtcggatccggcg
aaatacggcgatccggatcattattccaaacggtacaccggcacacaagacaatggagga
gtccatacaaacagcggcatcatcaataaagcggcgtacttgctcagccaaggcggcgtc
cattacggcgtaagcgtcaccggcattggccgcgacaaaatggggaaaattttctaccgg
gcgcttgtctactatttgacgccgacgtcgaacttcagccagctgcgcgccgcctgcgtg
caagcggccgctgatttgtacgggtcgacaagccaagaagtcaattcggtgaaacaggcg
ttcaatgcggttggagtgtattaa

DBGET integrated database retrieval system