KEGG   Geobacillus lituanicus: GLN3_11485Help
Entry
GLN3_11485        CDS       T05193                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
gli  Geobacillus lituanicus
Pathway
gli00473  D-Alanine metabolism
gli00550  Peptidoglycan biosynthesis
gli01100  Metabolic pathways
gli01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gli00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    GLN3_11485
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    GLN3_11485
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    GLN3_11485
Enzymes [BR:gli01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     GLN3_11485
Peptidoglycan biosynthesis and degradation proteins [BR:gli01011]
 Precursor biosynthesis
  Amino acid ligase
   GLN3_11485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST GARS_A
Motif
Other DBs
NCBI-ProteinID: ASS87624
UniProt: A0A223DXA5
LinkDB All DBs
Position
2302925..2304019
Genome map
AA seq 364 aa AA seqDB search
MKTRVGVLYGGKSPEHQVSLSTAMAVMNAIDPHKFDVIPIYITPQGQWIKGKRLTGPVKE
VKQLQFTSTATAMIPVSLNQVPASESSSADSEETIDVIFPLLHGPNGEDGTVQGLLEMLN
LPYVGNGVLASAVGMDKVIMKNLFAQAGLRQAKYVAVTKYDWQKSGEAVYDRIERELGYP
CFVKPANAGSSVGISKCKQRGDLHKAFAEAFKYDRKIIIEEAIVGREIEIGVIGNDEPIC
SVVGEIVPKKEFYDYEAKYEDGQTELIIPAKVTPEQYETIKEMAIAAFKALDLSGLVRAD
FFLAEDGTVYINEINTMPGFTPYSMFPLLWQHSGVPYPELIERLIALALERHQEKQTITY
TFEK
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgagagtcggagtgttgtatggcgggaagtcgccggagcatcaagtatcgttg
tcaacggcgatggcagtgatgaacgccatcgatccccataaatttgatgtgattccgatt
tacattactccacaagggcagtggattaaaggaaagcgattgaccggaccggtcaaagaa
gtgaaacagctgcagttcacgtcgacagcgacggccatgatcccggtatctttaaaccag
gtgccggcgtcggaatcgtcgtctgcggacagcgaggaaacgattgacgtcatcttcccg
cttttgcatgggccgaacggcgaagacggaactgtgcaaggactgctcgaaatgttaaac
ctcccgtacgtaggcaacggtgtgcttgcctcggccgtcggcatggataaagtgattatg
aaaaacttgtttgcccaagccgggctgcgccaggcgaaatatgtggcggtgaccaaatat
gactggcaaaaaagcggggaagccgtttacgaccggatcgaacgagagcttggctacccg
tgctttgtcaagccagccaacgccggttcgagcgtcggcatttccaaatgcaagcagcgc
ggcgatttgcacaaggcgtttgccgaagcgtttaagtatgaccggaaaatcatcattgaa
gaagcgatcgtcggccgggagatcgagatcggcgtcatcggcaatgatgaaccgatttgt
tcggtcgtcggagaaattgtgccaaaaaaggaattttacgactatgaggcaaaatatgaa
gacggacaaacggaactgattattcccgctaaggtgacgccagagcagtatgaaacgatt
aaggaaatggccattgccgcgtttaaagcgcttgacttgtccgggctcgtgcgtgccgac
tttttcctcgctgaagatggcactgtgtatattaacgaaatcaatacgatgccgggattt
accccgtacagcatgtttccgcttctttggcagcacagcggcgtgccgtatccggaactg
atcgagcgcctcattgcgctggcgttggaacggcatcaagaaaagcagacgatcacgtac
acatttgaaaaataa

DBGET integrated database retrieval system