KEGG   Gloeobacter kilaueensis: GKIL_4101Help
Entry
GKIL_4101         CDS       T02885                                 

Gene name
gst
Definition
(GenBank) glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
glj  Gloeobacter kilaueensis
Brite
Enzymes [BR:glj01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     GKIL_4101 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: AGY60347
UniProt: U5QN02
LinkDB All DBs
Position
4319012..4319722
Genome map
AA seq 236 aa AA seqDB search
MIDLYYWPTPNGHKIAIFLEEAGLDYRIVPVNIAVGDQFKPDFLRIAPNNRMPAIVDHQP
EDGGEPVSVFESGAILLYLAEKTGQFLPADRRGRVAVSQWLFWQMGGLGPMAGQNHHFSQ
YAPEKIPYAIDRYVRETNRLYGVLDRQLAGRDFIAGTYSIADMACYPWIVPHERQGQRLE
DFAHLKRWFDVIASRPAVLRAYEKGQPFSGQPTVSEESRRILFGQTAASVQSSSGS
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacctgtactactggccgacgccgaacggccacaagattgcgatctttttggag
gaagcggggctcgactaccggattgtgccggtaaatatcgcggtgggcgaccagttcaag
cccgattttttgcgcattgcccccaacaaccggatgcccgcgatcgtcgatcaccagccg
gaggacggcggtgaacccgtctccgtcttcgagtccggcgcgattttactgtatctggcc
gagaaaacgggccagttcctacctgccgaccggcgcggacgagtggcggtgagccagtgg
cttttctggcagatgggcggtctggggccgatggcaggccagaaccatcacttcagccag
tacgcgcctgagaagatcccctacgccatcgatcgctacgtcagagaaaccaaccggctt
tacggtgtgctcgaccggcaactggcaggacgcgacttcattgcaggcacctattcgatc
gccgacatggcctgctatccgtggatcgtgccccacgagcggcaagggcagcgcctcgaa
gactttgctcacctcaagcgctggttcgatgtgatcgcctctcgccccgccgtcctccgc
gcctacgaaaagggccagcccttcagcgggcagccgacggtaagcgaagagagccgcagg
attctctttggtcagaccgccgccagcgttcagtcctcctccggctcatag

DBGET integrated database retrieval system