KEGG   Gloeobacter kilaueensis: GKIL_4210Help
Entry
GKIL_4210         CDS       T02885                                 

Gene name
nrtB
Definition
(GenBank) nitrate ABC transporter inner membrane subunit
  KO
K15577  
nitrate/nitrite transport system permease protein
Organism
glj  Gloeobacter kilaueensis
Pathway
Nitrogen metabolism
ABC transporters
Module
Nitrate/nitrite transport system
Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:glj00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    GKIL_4210 (nrtB)
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    GKIL_4210 (nrtB)
Transporters [BR:glj02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    GKIL_4210 (nrtB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4423564..4424403
Genome map
AA seq 279 aa AA seqDB search
MTTTLDTRSRQTTSQRWTALINGKKLQRIIAPAVAITSVLVLWQLLCSLPGATLPTPTQV
VSDTWELIVNPFYQGTGTNKGLFWQIAASLQRVAIGYTAAAIVGVALGILIGVNRLFYAG
LDPLVQVFRTIPPLAWLPISLAAIQKSELAALFVIFITAIWPILINTAVGVQRIPADYNN
VARVLKLPKLKYFFKILLPASLPYIFTGLRLGIGLSWLAIVAAEMLIGGVGIGFFIWDAY
NSAKVSDIILALLYVGLVGLLLDKLVGFAGSLIVPAERK
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgacgacaacactggacacgcgcagccgtcagaccaccagccagcggtggacggctctt
atcaacggcaagaagttgcagcggatcattgctccggcggtggcgatcacctcggtgctg
gtgctctggcagctcctgtgctcgctgccgggggcgaccctgcccaccccgacccaggtg
gttagcgacacctgggagctgattgtcaatcctttttatcagggcaccggcaccaacaag
ggcctgttctggcagatcgccgcgagcctccagcgcgtcgcgataggttacaccgcagcg
gcgatcgtgggggtggcgctggggatcttgatcggggtcaaccgcctcttctacgccggt
cttgaccccctggtgcaggtatttcgcacgattccgcccctggcctggctgccgatttcg
cttgcggccatccaaaaatcggaactggcggcgctgtttgtgatctttatcaccgccatc
tggcccatcttgatcaacactgccgtcggcgtccagcgcattccggctgactacaacaac
gtcgcccgcgtcctcaagttgccgaagctcaagtacttcttcaagatcttgctgccagcc
tcgctgccttacatcttcaccggcctgcggctgggcatcggtctatcgtggcttgcgatt
gtagcggcggagatgctcatcggcggcgtcggcatcggcttttttatctgggacgcctac
aacagcgccaaggtgagcgacatcatcctcgccctgctctacgtcggcctggtgggcctg
ctgcttgacaaactggtcggttttgcaggctcgctgatcgtcccggcggagcgcaagtaa

DBGET integrated database retrieval system