KEGG   Glarea lozoyensis: GLAREA_03299Help
Entry
GLAREA_03299      CDS       T04883                                 

Definition
(RefSeq) Cu,Zn superoxide dismutase-like protein
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
glz  Glarea lozoyensis
Pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:glz00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    GLAREA_03299
Enzymes [BR:glz01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     GLAREA_03299
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 219 aa AA seqDB search
MVKAGMSSSNSSLSTVCAADGILSQCGVTKSGFEQDLFHGPPGWLPAPATQSILQEVAAR
VDGIDVVAPVCKIRGDGKITGTFTFEQESESSSTNISWDITGHDANSERGCHIHQFGDNT
NGCTSAGPHFNPHGKTHGAPDDETRHVGDLGNLKYDGQGNAKGSTTDKLIKLIGPESVIG
RTVVVHAGVDDLGKGGNEESKKTGNAGLRPACGVIGIAA
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaagcaggtatgtcatcgtcaaattcatctctctccaccgtttgtgctgcagac
gggatcttgagccagtgcggggtcaccaagagcggctttgagcaagatttattccatgga
ccacctggatggttaccggcaccagctacccaatccattctgcaagaggtagcggcacga
gtggacggtatcgatgttgttgccccggtctgcaaaatccgaggtgacggaaagatcacc
ggtaccttcaccttcgagcaggaatccgaatcttcttccaccaacatctcatgggatatc
accggccacgatgccaactccgagcgaggatgccacattcatcaattcggtgacaacacc
aacggctgcacatccgctggtcctcacttcaacccacacggaaagacacacggtgctcca
gatgacgagacccgccacgttggtgatttgggcaacttgaagtatgatggtcaaggaaat
gccaagggcagcaccaccgacaaactcatcaagttgattggcccagagagtgttatcgga
cgtaccgtcgtcgtccacgccggtgttgatgatcttggtaagggaggaaacgaggaatcc
aagaagaccggaaacgctggtctccgacctgcttgtggtgtcattggcattgctgcttag

DBGET integrated database retrieval system