KEGG   Glarea lozoyensis: GLAREA_03969Help
Entry
GLAREA_03969      CDS       T04883                                 

Definition
(RefSeq) Glutathione S-transferase (GST), C-terminal
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
glz  Glarea lozoyensis
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:glz00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    GLAREA_03969
Enzymes [BR:glz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     GLAREA_03969
Transporters [BR:glz02000]
 Other Transporters
  Pores ion channels [TC:1]
   GLAREA_03969
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 223 aa AA seqDB search
MSLKPIHLYTHAGGPNPWKLAILLSTLQIPYTQTFVPFSDIKKPEYLAICPNGRVPAIVD
PNTNVTMWESGAIMEYLVETYDKEGEYWVKEGGERWVGKSWLFFQMSGQGPYFGQAIWFT
RYHSEKIDSAKLRYINEIYRVFSVLDTALEGKSYLVAEKCTIADLSFIPWNYHILRLEGV
DVAMVEKSYPRFWEWHHRLLEREAVKKVMSEREGIMAEEARGK
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgtcacttaaaccaatccacctctacacccacgccggcggtcccaacccctggaaactc
gccatcctcctcagcaccctacaaatcccctacacacaaaccttcgtccccttctccgac
atcaaaaaacccgagtacctggccatatgtcccaacggccgggtgccagcgatcgtcgac
ccgaacacgaatgttaccatgtgggaaagcggcgccatcatggagtacctggttgagacg
tatgataaggagggggagtattgggtgaaggagggaggggagaggtgggtggggaagagt
tggttgttttttcaaatgtcaggacaaggtccctatttcggccaagcaatctggttcacg
cggtaccactccgaaaaaatcgactcagcgaaactgcggtatataaatgagatataccgt
gtattctccgtccttgacacagctttagaaggaaaatcgtatttggttgctgagaaatgt
acgatcgcggatctatcgtttataccgtggaactaccatattctgcgtcttgaaggtgtg
gatgtggcgatggtggagaaatcgtatccgcggttttgggagtggcatcataggttgttg
gagagggaggcggtgaagaaggttatgagtgagagggaggggattatggctgaggaggcg
agagggaaatag

DBGET integrated database retrieval system