KEGG   Glarea lozoyensis: GLAREA_08646Help
Entry
GLAREA_08646      CDS       T04883                                 

Definition
(RefSeq) Heme-dependent peroxidase
Organism
glz  Glarea lozoyensis
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase p450
Motif
Other DBs
NCBI-GeneID: 19467694
NCBI-ProteinID: XP_008075798
UniProt: S3EDX2
LinkDB All DBs
Position
Unknown
AA seq 1061 aa AA seqDB search
MPSQFKTLIGSMRRKPAMAPDGKRDEEVTPVMEKTTLGHDLTQLSFKDVKFVATAITTLV
SGDPLDDKELLLEHGVELLQSLPLNSGLQDKISSDFIAMLYQDLPHPPPTTSGPSARYRK
HDGSGNNPWIPEMGRAGAPYSRSVPPIKTKGPNLPDPELVYDQLLKRRGPFREHPSGLNR
LFFSFATVVIHEIFQTSRTNPWINETSGYVDLSTLYGNTEKEQKRVRTYENGKLFPDSIA
SERIMMMPPGVVIVVLLFCRNHNHIAENILSVNEEGKYKNWDELDDRQKIAQDEDIFQVT
RNINVGYFASVVLKDYVASILNTPRANSSWSLDLGKEIKQSGKRVERGTGNVVSVEFAVL
YHWHAALSAADDRWMENIVRAVIPDLISIDDLTAEQFQTVTRTTGHNLMKSEARAWTFGG
LKRQEDGRFNDTDLANIIKDCIEEPAHAFGAHSNPASLKVVDLMGQIQARDIFNVCTLNE
QVPFYSTRLLANGEWNDDKNTARAAELLYGHIENLELYPGLMAENTKPAMPGSGVCPGQT
TGRGILDDAVALVRGDRFLSYDFNSTTLSNFGFAKLQNIPSGSYGGILPHLLFNGLPGAW
TGTSAYALLPFYTPKAQYDILKGNKVIGQYDLERPANGMEVIGIHTHEGCKKVFEDRENF
RVMYQKAIRECTDGHDFMIGFDDAKRHDARSSILYKAFFEEGFEAKVSQFFKTNVSKLIK
SSSLKYSNSTRRSVDIVRDVTNVAPILWLAERFAIPLKTHEKPHGVISIPEAFAAFLVLF
MYQSFNIIPANEWKLREGAMKAGPILRKIFDTHLRTQQGFREKAVDWLAKGSAFEVGPEA
DRLYHALNDSKLPIGDLVGDCIGMGAPVAGNLTQQASLLIDLYLSEGYEEYKARIVELSH
MTDAASERELQGFVFEGMRHAGVVPGLPRVTSKDITIIDGARGPIHIQSGHTILIATSKA
NMDPLAFSNPEKLNPHRPFDDYTLLGHGLHFCFGTRLVGCSLAATLREVFKLKNVRRAPG
RQGHFTVTEHEFAGVKMRHYLDASAKESPIPTTLTLEYDEE
NT seq 3186 nt NT seq  +upstreamnt  +downstreamnt
atgccgtctcaatttaaaaccctgattggaagcatgaggagaaagccggcaatggctcct
gatggaaagcgagatgaagaagtaactccagtaatggagaaaacaacacttggtcacgat
cttacccagcttagtttcaaggatgtaaaatttgtagcgactgcgattaccaccttagtt
tcaggtgatcctctggacgataaagagcttctattagaacatggagtcgagttgcttcaa
tctttgccccttaacagtggtttgcaagacaaaatctccagcgacttcattgccatgctc
tatcaggatcttcctcatcctcctcccacaacaagcggcccatccgccagatatcgaaaa
cacgacggaagtgggaacaatccttggattcctgagatgggaagagctggagcaccatat
tctcgcagtgttcctccaatcaaaacaaaaggtccaaatctccctgaccccgaactcgtc
tatgaccaacttctcaaacgcagaggaccatttcgcgaacatccttctgggttgaaccgg
ttgttcttctctttcgctactgttgtcatccacgagattttccaaacttctcgcaccaat
ccttggatcaacgagacttctgggtatgtcgatttgagtacactttacggcaataccgag
aaagaacagaaacgggtccgcacttatgagaatggaaaacttttccccgactcaattgct
tctgagagaatcatgatgatgcctccaggtgttgtcattgttgtacttctgttctgccga
aatcataaccacattgctgaaaatatattatcggtgaatgaggagggtaaatacaagaat
tgggatgagcttgatgacaggcaaaagattgcacaagatgaagatatcttccaagttact
cgaaatatcaatgttggctacttcgcgtcggtggtattgaaggactatgttgcatcaatt
ctcaacaccccacgagctaattcgtcttggtctcttgatcttggcaaggagatcaagcaa
tcaggaaaacgtgttgaaagagggactggaaatgttgtttccgtcgagttcgctgttctt
tatcattggcacgccgccttgtctgctgctgatgacagatggatggagaacatcgttcga
gctgtcattccagatttgatatcgattgatgacctaacagccgagcaattccagacggtc
actaggaccactggtcataacctgatgaagagtgaggcaagagcatggacttttggaggt
ctcaaaagacaagaggacggcagattcaatgacactgaccttgccaacatcatcaaagac
tgtattgaggagccggctcatgcatttggagcccacagtaacccagctagtttgaaggtt
gtggatctgatgggtcaaattcaggctagagacattttcaatgtctgcacgctaaatgag
caagtgccattttactcaacacgcttacttgctaacggtgaatggaatgacgacaagaat
actgctagagctgctgaactgctttacggtcatatcgaaaatcttgaactatacccgggg
ctgatggctgaaaacaccaagcctgctatgccaggaagtggggtgtgtcccggacagact
actggacgtggtattctggacgatgccgtagctctcgttcgtggagatcgcttcctcagt
tacgacttcaacagcaccactttgagcaacttcggatttgccaaacttcaaaatatccca
tctggatcatacggtggaatcctcccacacttgctcttcaacggtctcccaggagcatgg
accggcacatcggcctatgccctgctcccattttatacccccaaagcccaatatgacatc
ctcaaaggcaacaaagttattgggcaatacgacctcgaaagaccagccaacggcatggaa
gtgattggtatccacacccatgagggttgcaaaaaggtcttcgaagaccgcgaaaacttc
cgcgtcatgtatcaaaaggcgattcgtgaatgcactgatgggcacgatttcatgatcggc
ttcgacgacgccaaacgccatgacgcgcgctcaagcatcctctacaaagcctttttcgaa
gaaggatttgaggcgaaagtctcccagttctttaagaccaacgtatcgaaactcatcaag
tctagctcattaaagtattccaacagcacccgtcgctccgttgatatcgtgcgcgatgtc
acgaacgttgcgcccattctctggctcgcagagcgttttgccatcccactcaaaacgcac
gagaagcctcacggagtaatctctattcctgaagcttttgccgcttttctcgttctgttc
atgtatcaaagcttcaacatcataccagccaatgaatggaagctccgagaaggcgctatg
aaagccggtcccatcctacgcaaaatcttcgatacgcacctcagaactcaacagggcttt
agggagaaggctgtagattggcttgcaaaaggttctgctttcgaagtaggccccgaagcg
gatcgtctctaccacgctctcaacgactcgaagctccccattggagacttggtcggagat
tgtatcggtatgggtgcgcccgtcgctggaaatctcactcaacaagcctctctcctgatc
gacctatatctgagcgagggatacgaagagtacaaagcgcgtatcgtagagctgtcacac
atgaccgacgctgcttcagagcgcgaactccagggtttcgtctttgaaggtatgcgtcac
gcaggcgtcgttccgggtcttcctcgcgttacctcgaaggatataactatcatcgatggt
gcgcgcggtccaattcatattcaatctggccacaccattctcattgctacctccaaggca
aacatggatccgctcgctttctcaaaccccgagaagctgaacccacatcgtccatttgat
gactatactctcttaggccatggactccatttctgcttcggaacaagattggtgggatgt
agtcttgcagcgacgttgagggaggtgttcaagttgaagaacgtacggagagcgcccggc
agacagggccatttcacggtgacggagcatgaatttgcgggcgtgaagatgaggcattat
ttggatgctagtgcaaaggagagtccgattccgacgacgttaacgttggagtatgatgag
gagtaa

DBGET integrated database retrieval system