KEGG   Glarea lozoyensis: GLAREA_09762Help
Entry
GLAREA_09762      CDS       T04883                                 

Definition
(RefSeq) Trypsin-like serine protease
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
glz  Glarea lozoyensis
Brite
Enzymes [BR:glz01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     GLAREA_09762
Peptidases [BR:glz01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   GLAREA_09762
Exosome [BR:glz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GLAREA_09762
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 281 aa AA seqDB search
MAPTLAFLATMLAMLPALNAAPTEVFSPNPKPIFERDPVPIPPSTSVGGASQIVGGSAAS
SGQFPYIVSLQKSGSHFCGGVLINSKTVVTAAHCSVGQSASSVKVRAGTLTWASGGTLVS
VSSIVVNPSYSSSTINNDVAVWKLATALPTSSTIKYATLPAQGSDPAAGTSTTTAGWGTT
SENSNSLPASLRYVSVPVISRSSCQASYGTSSVTTNMFCAGLAAGGKDSCSGDSGGPIIN
TSTGVLIGVVSWGQGCAEAGFPGVYTRLGNYVTWINANLAT
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggcgccaacacttgcatttttggcaactatgctcgccatgttgccagctctcaatgct
gcgccaactgaggtcttctctcctaacccaaagccaatctttgaacgcgacccagtccca
attccaccaagcaccagtgtaggtggtgccagccaaatcgttggtggatctgccgcttcc
tctggccaatttccctacatcgtcagcttgcaaaagagtggatctcacttctgtggtggt
gttctcatcaatagcaagaccgtggtgaccgccgcccactgctcggtgggacagtctgct
tcctctgtcaaagtccgcgccggaactctcacttgggcctctggtggtactttagttagt
gtttcatccatcgtcgtcaacccatcttacagctcctccaccatcaacaacgatgttgcc
gtttggaagttggcaactgcccttccaacaagcagcaccatcaaatatgccactcttcca
gcccaaggttcagacccagctgctggtacttctacaactaccgctggatggggtacaaca
agcgagaactcgaactctcttccagcctctttgagatacgtttcagtgccagtgatctcc
cgatcatcttgccaggctagctacggtacctcttccgtcacaaccaacatgttctgtgct
ggtctggctgcgggaggaaaggattcgtgctcaggtgacagtggtggtccaatcatcaac
accagcactggtgtcttgatcggtgttgtttcttggggtcaaggatgcgctgaggctgga
ttcccaggagtctacactagactcggtaactacgtcacctggatcaacgccaacttggct
acgtaa

DBGET integrated database retrieval system