KEGG   Glarea lozoyensis: GLAREA_11708Help
Entry
GLAREA_11708      CDS       T04883                                 

Definition
(RefSeq) UDP-Glycosyltransferase/glycogen phosphorylase
  KO
K00693  
glycogen synthase [EC:2.4.1.11]
Organism
glz  Glarea lozoyensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:glz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GLAREA_11708
Enzymes [BR:glz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     GLAREA_11708
Glycosyltransferases [BR:glz01003]
 Polysaccharide
  Storage polysaccharide
   GLAREA_11708
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 708 aa AA seqDB search
MAQDLSIHNPKRDIRDHYLFEIATEVANRVGGIYSVIKSKAPVTTAEYGDRYCLIGPLNK
ASAAVEVEALTPTNPHLAKTIESMEERGISMVYGRWLIEGAPRVLLIDTKTAYRFLDEWK
ADLWNTAGIPSPPGDDETNEAVVFGYLVAWFLGEFVAHETEKAVIAHFHEWLSGVALPLC
KKRRIDVTTIFTTHATLLGRYLCAGSVDFYNNLQYFDVDAEAGKRGIYHRYCIERASAHS
CDVFTTVSHITAYESEHLLKRKPDGVLPNGLNVTKFSAMHEFQNLHQQAKEKIHDFVRGH
FYGHNDFDPDNTLYFFTAGRYEYRNKGVDMFIESLARLNHRLKSAGSKMTIVSFIIMPAQ
TQSLTVEALKGQAVIKSLRDTVDVIERGVGKRIFERALKWHDGDAMPDDKDLISSQDKIL
LRRRLFAMKRHGLPPIVTHNMANDAEDPILNQIRRVQLFNHPSDRVKIVFHPEFLNSANP
VLPMDYDDFVRGTHLGVFSSYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEELIENSTD
YGIYIVDRRMKGVDDSVNQLTSFMYDFANKSRRQRINQRNRTERLSDLLDWKRMGMEYVK
ARQLALRRAYPASFEGEDDEDYIPGVEQKISRPFSVPGSPRDRSGMMTPGDFASLQEGRE
GLSTEDYVAWKLPEEEDPEEYPFPLTLRSKKATGPTSPAEAVITNGTS
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atggcccaagatttgagcatacacaatccgaagagagatatccgcgatcactaccttttt
gagatcgcaaccgaagttgcgaatcgagttggtggtatctactctgtcattaaatcgaaa
gctccagttacaaccgccgaatatggcgaccgatactgccttattggcccccttaacaaa
gcctcagctgctgtcgaagttgaagcccttacacctaccaatccacacttagctaagaca
atcgaatcgatggaagagagaggtatcagcatggtttacggaagatggttgatcgaggga
gctcccagagtcctgttaattgatacaaaaactgcctacagattcttggatgagtggaaa
gcggatctgtggaatacagcaggaattccttcgcctccaggagacgatgagaccaatgaa
gctgtcgtcttcggttacttggttgcgtggttcttgggagagttcgtcgcacacgagaca
gagaaggccgtcattgcgcatttccatgaatggttatctggtgtagcccttcctctatgc
aaaaagcgaagaatcgatgtcaccaccatcttcaccacacacgcaacccttctaggaaga
tatctctgcgccggttccgttgatttctacaataacctacagtactttgatgtagatgct
gaagctggaaagcgtggtatctaccatcgttactgcattgagcgcgcttctgcacactcc
tgcgatgttttcaccaccgtttcccacattactgcatacgaatcggagcatctcctaaag
cgcaagccagacggtgttcttcctaatggtctcaatgttacaaaattctccgccatgcac
gagttccagaatcttcaccagcaagcgaaagagaagatccatgactttgttcgaggtcat
ttctacggacataacgatttcgatccagacaataccctctactttttcactgccggtcgt
tacgagtacaggaataagggcgttgacatgtttattgaatcattggcgagattgaaccac
agactcaagtccgctggatctaaaatgactattgtctcattcatcattatgcctgcgcaa
acgcagtcattgactgttgaggcattgaagggtcaggccgtcatcaagtctctgcgcgac
acggtagatgttatcgaacgtggagtaggaaaacgaattttcgagcgtgcgctgaaatgg
cacgatggagatgctatgccagatgacaaggatttgattagcagccaggacaaaattctc
ctccgccgaagactgttcgcaatgaagagacatggacttcctccaattgttacacacaac
atggcaaatgatgctgaggatccaattctcaaccagatccgaagagtccaacttttcaac
cacccatctgacagagtcaagattgtcttccacccagagttcttgaactcggccaaccca
gttctgccaatggattacgatgatttcgttcgaggtacccatcttggtgtattctcctct
tactacgagccatggggatacacacccgccgaatgtacggttatgggagttcctagcatt
accactaacctctcaggtttcggatgttacatggaagaattgattgagaactctaccgac
tacggaatctatatcgtcgatcgccggatgaagggtgttgatgattcagttaaccagctt
acttctttcatgtacgatttcgccaacaagtcaagacgtcaacgtatcaaccaacgtaac
cgtaccgagcgactgagcgatcttctcgactggaaacgaatgggaatggaatacgtcaag
gcgagacaattagcacttcgcagagcatacccagcatcgttcgagggcgaggacgatgaa
gactacattccaggtgttgagcagaagatttcaagaccattctccgtacctggttcgcca
agagatcgcagtggaatgatgactcctggtgatttcgctagtctacaggaaggacgagag
ggtcttagcaccgaggactatgtcgcgtggaagctcccagaagaggaagacccagaagag
tatcccttcccgctcacccttcgatcaaaaaaggcgaccgggccaacaagccccgctgag
gcagtcatcacgaacggtacctcataa

DBGET integrated database retrieval system