KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_0108Help
Entry
GY4MC1_0108       CDS       T01348                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
gmc  Geobacillus sp. Y4.1MC1
Brite
Translation factors [BR:gmc03012]
 Eukaryotic Type
  Elongation factors
   GY4MC1_0108
 Prokaryotic Type
   GY4MC1_0108
Mitochondrial biogenesis [BR:gmc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    GY4MC1_0108
Exosome [BR:gmc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   GY4MC1_0108
  Exosomal proteins of breast cancer cells
   GY4MC1_0108
  Exosomal proteins of colorectal cancer cells
   GY4MC1_0108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
133163..134350
Genome map
AA seq 395 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITTVLAKQGKAEAKAYDQIDAAPEERERG
ITISTAHVEYETDKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLSEYDFPGDEVPVIKGSALKALE
GDPQWEEKIVELMNAVDEYIPTPQREIDKPFMMPIEDVFSITGRGTVATGRVERGTLKVG
DAVEIVGLSDEPKSTTVTGVEMFRKLLDQAEAGDNIGALLRGVSRDEVERGQVLAKPGTI
TPHTKFKAQVYVLTKEEGGRHTPFFSNYRPQFYFRTTDVTGIITLPEGVEMVMPGDNVEM
TVELIAPIAIEEGTKFSIREGGRTVGAGSVSEIIE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagcgaaattcgaacgtacgaaaccacacgtcaacattggtactatcggccac
gttgaccatggtaaaacgacgttaactgctgcgattacaacagttctcgctaaacaaggt
aaagcagaagcaaaagcgtacgatcaaatcgacgcagctccagaagaacgtgaacgtggt
atcactatctctactgcgcacgttgagtatgaaacagacaaacgccactatgctcacgtt
gactgccctggccacgcagactacgtgaaaaacatgatcacaggtgcagcgcaaatggac
ggtgcaatccttgttgtgtctgcggctgacggtccaatgccacaaactcgtgagcacatt
cttctttctcgccaagtaggtgtgccatacatcgttgtattcttgaacaaatgcgacatg
gttgacgacgaagaattgctagaacttgttgaaatggaagttcgtgatctattatctgaa
tatgatttccctggcgacgaagtgcctgttatcaaaggttctgcgttaaaagcgcttgaa
ggcgatccgcaatgggaagaaaaaattgttgaattgatgaatgcggttgacgaatatatc
ccaactccgcaacgcgaaattgacaaaccattcatgatgccaatcgaagacgtattctcg
atcactggtcgcggtacagtagcaactggccgtgttgaacgcggtacgttaaaagttggc
gatgctgttgaaatcgttggtctttctgatgaaccaaaatctacaacggttactggcgtt
gaaatgttccgcaaacttcttgaccaagcagaagctggtgacaacatcggtgcgcttctt
cgcggtgtgtcccgtgatgaagttgagcgcggtcaagttcttgcaaaaccaggaacaatt
acaccacatacaaaatttaaagctcaagtttacgtcctaacaaaagaagaaggtggacgc
catactccattcttctctaactatcgtccacaattctacttccgtacaacggacgtaaca
ggcatcatcacgcttcctgaaggcgttgaaatggttatgcctggcgacaacgttgaaatg
acagttgaattaatcgcgccaatcgcgatcgaagaaggtacaaaattctcgatccgtgaa
ggcggacgtactgtaggtgctggctctgtatctgaaatcattgaataa

DBGET integrated database retrieval system