KEGG   Geobacter metallireducens: Gmet_1644Help
Entry
Gmet_1644         CDS       T00295                                 

Definition
(GenBank) pyridoxal-5'-phosphate-dependent decarboxylase
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
gme  Geobacter metallireducens
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Quorum sensing
Brite
KEGG Orthology (KO) [BR:gme00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Gmet_1644
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Gmet_1644
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Gmet_1644
   00430 Taurine and hypotaurine metabolism
    Gmet_1644
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Gmet_1644
Enzymes [BR:gme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Gmet_1644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
1845016..1846668
Genome map
AA seq 550 aa AA seqDB search
MPKNRDAARASLENLYRIFTVPEAPDSTLGAIDQAIAGDVAGFLQTHIVAIERPLEEIEA
DFSSFSIPEEPTYVSEYTEFVKENLVAHSVHTASPAFVGHMTSALPYFMLPLARLMTALN
QNVVKVETSKAFTPMERQVLAMLHHLVYGRNDDFYPQWIHNSQHALGAFCSGGTLANVTA
LWVARNRLFAPDGEFRGIAQEGLARALKHRGADGIAVLVSERGHYSLGKAADLLGIGRDD
LIKIKTDANNRIDLKALREECRRLQDRNTLPLALVGIAGTTETGNVDPLEAMADLAQELG
CHFHVDAAWGGPTLFSDRHRHLLRGIERADSVTIDGHKQLYVPMGAGMVVFKDPTALSAI
EHHANYILRHGSKDLGSHTLEGSRPGKAMLVHAGFSIIGRKGYELLIDMGIERARTFADM
IQRHPDFELISEPELNILTYRYCPPAIQQALTDATAQQRAAINGLLDQVCQLLQKYQREA
GKTFVSRTRLHVARHDMELTVLRVVLANPLTTDEILEAVLAEQCEIVRLPEIQALLRQAE
ELCPGLAKAV
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaaaatcgtgatgcagcccgtgccagcctggaaaacctctaccggatcttcacc
gtgccggaagcacccgactcgaccctcggcgctattgatcaggcgattgccggcgatgtc
gccggcttcctgcagacccatatcgtcgccatcgaacgccctctcgaagagatcgaagcg
gatttctcctccttctccatacccgaggaaccgacctacgtctccgagtataccgaattc
gtcaaagagaacctcgtcgcccactcggtccataccgcctcaccggcctttgtcggccac
atgacctcggcgctcccctacttcatgctcccgctggcacgcctcatgaccgccctcaac
cagaatgtggtcaaggtggagacatccaaggcctttacgcccatggagcgccaggtcctt
gccatgcttcatcacctggtctatggccggaatgacgacttctacccgcaatggattcat
aacagccagcatgccttgggggccttctgctccggcggcaccctcgccaacgtcacggcg
ctatgggtggcgcgcaaccgcctgttcgctccggacggagagttccgcggcattgcccag
gaagggttggcccgtgccctgaaacatcgcggcgcggacgggattgccgttctcgtttcc
gagcgcggccactactctttgggcaaggccgccgacctcctcggtatcggcagggatgac
ctgattaagataaagacggatgcaaacaaccgtatcgacctcaaggcgttgagagaagaa
tgccggcgactgcaggatcggaacaccctcccgctggctctggtcggcatcgccgggacg
accgaaaccggcaacgtcgacccgctggaggcaatggccgatttagcccaagagctcggc
tgtcattttcatgtggatgccgcctggggggggccaacccttttttccgaccggcaccgt
cacctgctccgcggaatagaacgggccgactcggttaccattgacgggcacaaacagctc
tatgtgccgatgggggcggggatggtcgtcttcaaggatcccaccgccctctcggctatc
gagcatcatgccaactatatcctgcgtcatggctccaaggacctgggcagtcataccctg
gaagggtcgcggccagggaaggcgatgctggttcatgccgggttttcgatcattggccgc
aaggggtacgagcttcttatcgatatggggatcgagcgggcacgcacctttgccgacatg
atccagcgccatcccgatttcgagctgatcagcgaaccggaactgaatattctcacctac
cgctactgtccgcctgccatccagcaggccctgaccgacgcgacggcccaacagcgcgcc
gcaatcaatggacttcttgatcaggtctgtcagctgttgcagaaatatcagcgcgaagcg
ggtaaaacctttgtctctcgaacacggctgcatgtggctcgccacgacatggagctcacg
gtcttacgtgtcgttctggccaatccgctgacgaccgatgagattctggaggcagttttg
gcggaacaatgcgaaatcgtgcgtctgccggagattcaggccttgctgcggcaggctgag
gaactctgtcccggtctggcgaaagctgtctaa

DBGET integrated database retrieval system