KEGG   Glycine max (soybean): 100305870Help
Entry
100305870         CDS       T01710                                 

Gene name
GSTU35
Definition
(RefSeq) uncharacterized LOC100305870
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
gmx  Glycine max (soybean)
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100305870 (GSTU35)
Enzymes [BR:gmx01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100305870 (GSTU35)
Transporters [BR:gmx02000]
 Other Transporters
  Pores ion channels [TC:1]
   100305870 (GSTU35)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
8
AA seq 205 aa AA seqDB search
MGSEDVKLLNFWVSPFGKRVEWALKLKGVEYEYIEEDIFNKSNLLLELNPVHKKVPVLVH
AQKPIAESFIILEYIDETWKKYPLLPHNPYQRALARFWATCVEQKLGKAGWVAMSTSGDE
QEEAMKEAKEMMEKIEEEIKGKNFFGGDNIGYLDIAIGMDCLLGSCLGGSWINADNRPIE
ISSHLCMDDQFSQPPCDQRQLAPKR
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgggaagcgaagatgtgaagctgctgaacttttgggtgagtccatttggtaaaagggtt
gagtgggctttgaaactaaagggtgtggagtacgagtacattgaagaagatatctttaac
aagagcaatctccttctggagttgaacccggttcacaagaaggttccggttcttgttcat
gcccagaaacccatcgctgagtcattcatcatccttgaatacattgatgaaacatggaag
aagtatccattgttacctcacaatccttatcaaagagcacttgctcgattttgggcaacc
tgtgttgaacaaaagcttgggaaggctggatgggtagcaatgtctaccagcggcgatgaa
caagaagaggctatgaaagaagccaaagaaatgatggagaaaatagaagaagagattaag
ggaaagaatttttttggaggagacaatattgggtaccttgatattgcaattgggatggat
tgcttacttggttcctgtttgggaggaagttggatcaatgcagataatagacccattgaa
atttccagccacctttgcatggatgaccaattttctcagccaccctgtgatcaaagacag
cttgcccccaagagataa

DBGET integrated database retrieval system