KEGG   Glycine max (soybean): 100500504Help
Entry
100500504         CDS       T01710                                 

Gene name
RBCS-1, SRS1, rubpcase
Definition
(RefSeq) Ribulose bisphosphate carboxylase small chain 1, chloroplastic
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
gmx  Glycine max (soybean)
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Photorespiration
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    100500504 (RBCS-1)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    100500504 (RBCS-1)
Enzymes [BR:gmx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     100500504 (RBCS-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
13
AA seq 178 aa AA seqDB search
MASSMISSPAVTTVNRAGAGMVAPFTGLKSMAGFPTRKTNNDITSIASNGGRVQCMQVWP
PIGKKKFETLSYLPDLDDAQLAKEVEYLLRKGWIPCLEFELEHGFVYREHNRSPGYYDGR
YWTMWKLPMFGCTDASQVLKELQEAKTAYPNGFIRIIGFDNVRQVQCISFIAYKPPGF
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctcaatgatctcctccccagctgttaccaccgtcaaccgtgccggtgccggc
atggttgctccattcaccggcctcaaatccatggctggcttccccacgaggaagaccaac
aatgacattacctccattgctagcaacggtggaagagtacaatgcatgcaggtgtggcca
ccaattggcaagaagaagttcgagactctttcctacttgccagacctcgatgatgcccaa
ttggcaaaggaagtcgaataccttctaaggaaaggatggattccttgcttggaattcgag
ttggagcacggtttcgtgtaccgtgagcacaacaggtcacctggatactatgatggacgc
tactggaccatgtggaagctgcctatgtttggctgcactgatgcttctcaggtgttgaag
gagcttcaagaggctaagactgcataccccaatggcttcatccgtatcattggatttgac
aacgttcgccaagtgcagtgcatcagcttcatcgcctacaagcccccaggcttctaa

DBGET integrated database retrieval system