KEGG   Glycine max (soybean): 100803036Help
Entry
100803036         CDS       T01710                                 

Definition
(RefSeq) plastidial pyruvate kinase 2-like
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00010  Glycolysis / Gluconeogenesis
gmx00230  Purine metabolism
gmx00620  Pyruvate metabolism
gmx01100  Metabolic pathways
gmx01110  Biosynthesis of secondary metabolites
gmx01200  Carbon metabolism
gmx01230  Biosynthesis of amino acids
Module
gmx_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
gmx_M00002  Glycolysis, core module involving three-carbon compounds
gmx_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
gmx_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100803036
   00620 Pyruvate metabolism
    100803036
  Nucleotide metabolism
   00230 Purine metabolism
    100803036
Enzymes [BR:gmx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     100803036
Membrane trafficking [BR:gmx04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    100803036
Exosome [BR:gmx04147]
 Exosomal proteins
  Proteins found in most exosomes
   100803036
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PK PK_C HpcH_HpaI Cellulase
Motif
Other DBs
NCBI-GeneID: 100803036
NCBI-ProteinID: XP_003533962
LinkDB All DBs
Position
9
AA seq 577 aa AA seqDB search
MAQVAASRSIQSTPLCPTSGSARDRAQNLLKPPSFASKVFPFVGNNNKRSKLSLRGLQIS
ARKSAPSEVIPVSPEDDPKIEEHLQHLRGVQPFGENSVGMWSKPTFRRKTKIVCTIGPST
NTREMIWKLAEAGMNVARLNMSHGDHASHQKVIDLVKEYNASHGDNVIAIMLDTKGPEVR
SGDLPQPITLMPGQEFTFTIQRGVGTADCVSVNYDDFVNDVEVGDMLLVDGGMMSMVVKS
KTKDSVKCEVVDGGELKSRRHLNVRGKSATLPSITEKDWDDIKFGVDNKVDFYAVSFVKD
AEVVHELKNYLKSCGADIHVIVKIESADSIPNLHSIITASDGAMVARGDLGAELPIEEVP
LLQEEIINLCRSMGKAVIVATNMLESMIVHPTPTRAEVSDIAIAVREGSDGIMLSGETAH
GKFPLKAVKVMHTVALRTEATIPGGQMPPNIGPVLKNHMSEMFAYHATMMSNTLGTSTVV
FTRTGFMAVLLSHYRPSGTIFAFTDEKRVQQRLALYQGVCPIYMEFCDDSEATFRRALNL
LQKQGMVKEGEEVALVQSGRQPIWRFQSTHNIQVRKV
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atggctcaggtagctgcctcacgatccattcaaagcacccctttgtgccccacttctgga
tctgcacgtgacagagcccaaaacctgttaaagcctccatcttttgcttccaaggtgttt
ccttttgtagggaacaacaacaaacgctccaaactcagcctcagaggccttcagatcagt
gcaaggaaatcagccccttctgaagtcatccccgtgtcacccgaagatgatccaaagatt
gaggagcatttgcaacatttacgtggggtgcagccatttggtgagaactctgttggtatg
tggtctaagcccacgtttaggcgcaaaacgaagatagtgtgtactattggaccttctacc
aatacgagggaaatgatttggaagctggctgaggctggcatgaatgttgctcggttgaat
atgtctcatggagaccatgcttctcatcagaaagttattgacttggttaaggaatataat
gcttctcatggagacaatgtgattgcaatcatgcttgacacaaagggtcctgaagttagg
agtggggatttgccacaaccaattacattaatgcctggtcaggaattcacttttactatt
cagagaggtgttggaactgctgattgtgttagtgtgaactacgatgattttgtcaatgat
gtggaagtgggggacatgcttcttgtcgatggtggtatgatgtcaatggttgttaagtct
aagacaaaggattctgtgaaatgtgaagttgttgatggaggagagctcaagtcaaggcga
catttgaacgttagaggaaaaagtgcaactctgccttcaatcactgagaaggattgggat
gatatcaagtttggagtggataacaaagttgacttttatgctgtttcctttgttaaggat
gctgaagttgttcatgagctgaagaattatttgaagagctgtggtgctgatatacatgtc
atcgtaaaaatcgaaagtgcagactctataccaaatttgcattcaattatcactgcgtct
gatggggctatggttgccagaggagatcttggcgctgagctccctattgaagaggttcca
cttttgcaggaagagataatcaatttgtgtcgtagcatgggaaaggctgttattgtggca
acaaatatgctagaaagcatgattgttcacccaactccaaccagagcagaggtatcggat
atagcaattgctgttcgagaaggttctgatggaataatgttgtctggagaaacagctcat
ggaaagttcccactaaaagctgtgaaagtaatgcacacagtagcattacggactgaagct
actataccaggtggtcaaatgccacctaatattggtccagtgttgaagaaccacatgagt
gagatgtttgcataccatgcaaccatgatgtctaacactcttggaacctcaactgttgtc
ttcactagaacgggtttcatggctgtccttctgagccattatcgtccttcgggcaccata
tttgcttttacagatgagaagagggtacaacagaggctggctttgtatcaaggagtctgt
ccaatatacatggaattctgtgacgattctgaggcaactttcagaagagccttgaatttg
ctgcagaagcaaggaatggtgaaggaaggagaagaagtagcacttgtacaaagtggtagg
caacccatatggaggttccaatccacgcacaatatccaggttaggaaagtgtaa

DBGET integrated database retrieval system