KEGG   Glycine max (soybean): 100808183Help
Entry
100808183         CDS       T01710                                 

Definition
(RefSeq) histone-lysine N-methyltransferase ASHH3-like
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100808183
Enzymes [BR:gmx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100808183
Chromosome and associated proteins [BR:gmx03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100808183
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET DUF682
Motif
Other DBs
NCBI-GeneID: 100808183
NCBI-ProteinID: XP_006587390
LinkDB All DBs
Position
9
AA seq 364 aa AA seqDB search
MPLKESRISCTLSDFMPAMKKNPEQTHFGSVFNKLGKELGEPVDFELPDWFNKSKPMQYT
YIKRNIYLTKKVKRSRFDDDGIFCSCTPSPGSTSVCGRDCHCGMLLSSCSSGCKCGSSCL
NKPFQNRPVKKMKLVKTEKCGSGIVADEDIKLGEFVIEYVGEVIDDKTCEERLWNMKHRG
ETNFYLCEINRDMVIDATYKGNKSRYINHSCCPNTEMQKWIIDGETRIGIFATSDIQKGE
HLTYDYQFVQFGADQDCHCGAAECRRKLGVRPTKPKLSSDATLKLVAYQVYQNGGLQIGS
SRVVDQPKCLHNCIGEVIRIKQLGNERFGIIKRFDKYSRKHSIMFEDGCVEIYDMSKEDW
ELVR
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgcctttgaaggaatcaagaatatcctgtactctctcagatttcatgcctgccatgaaa
aagaatcctgagcagactcattttggatctgtattcaacaagttagggaaggagcttgga
gaacctgtagactttgaacttccagattggtttaataaatcaaagccaatgcagtacacc
tatataaaacgcaatatatatctcactaagaaggtcaagagatcccgatttgatgatgat
ggcatattctgttcatgtactccttcccctggatctactagtgtatgtggtagagattgc
cactgtggaatgcttctgtctagctgttcatcaggctgtaaatgtgggagctcctgtctc
aacaaaccatttcagaatcgtcctgtgaaaaagatgaaattagtcaagactgagaaatgt
ggttctggaattgtggcggatgaagatatcaagcttggggagtttgtcattgaatatgtt
ggagaagtcattgatgacaaaacatgtgaggaaaggctttggaacatgaaacatcgtggg
gaaacaaacttctacttatgtgaaatcaaccgagatatggtgatagatgccacatataag
ggaaacaaatcaagatacatcaatcatagctgctgccccaatactgagatgcagaaatgg
ataattgatggtgaaacaagaattggcatatttgcaactagtgacatacaaaagggcgag
catctgacttatgattaccagtttgttcaatttggtgcagatcaagattgccactgtggt
gctgctgagtgtaggcgtaagttgggtgtccgacctaccaagcctaaactttcttctgat
gctacattaaaattagtggcatatcaggtttatcagaatggaggtttgcaaattggaagt
tctcgtgttgttgaccaaccaaagtgcttacacaattgcattggtgaagttattaggata
aaacaacttggaaatgagaggtttggaattattaaacgatttgataaatattcccgaaaa
cactcgatcatgtttgaggatggttgtgttgaaatttatgacatgtcaaaagaggactgg
gaacttgtgagatag

DBGET integrated database retrieval system