KEGG   Glaciecola nitratireducens: GNIT_1032Help
Entry
GNIT_1032         CDS       T01632                                 

Definition
(GenBank) zinc-dependent metallopeptidase
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
gni  Glaciecola nitratireducens
Brite
Enzymes [BR:gni01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     GNIT_1032
Peptidases [BR:gni01002]
 Metallo Peptidases
  Family M2
   GNIT_1032
Exosome [BR:gni04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GNIT_1032
CD molecules [BR:gni04090]
 Proteins
  GNIT_1032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1128501..1130327)
Genome map
AA seq 608 aa AA seqDB search
MNKSKLSVLASILIALCAGCSPSNTSSTKPQALTLDADDAKAFLQKVDADITRLNKPASH
AAWAYATNINYDNAQVDAYLGEQLSVMWAKYAVEAAKFNDVVVDADTRRQLDLLKSGLEI
APPADPAKAERLAAIGSDLSGIYGAGKYCRSENECFSLVEMSAEMAVSRDPALMLEFWKG
WREVSVPMKEMFVEQVGIANEGAVELGYANTSELWRAKYDMPAEAFPKELDRLWGQIQPF
YNSLHCHVRAELSEHYGEEIVPLDKPIPAHLLGNMWAQSWGNIYDLVKPEQEMNLPDVTK
ALAEQGYDEIKMVKQAEGFFSSLGFAPLPDTFYERSMFQKPAERDVQCHASAWDVDEKDD
LRIKMCIQKTGEEFNVIHHELGHNYYQRAYKDQPMLYRGSANSGFHEAIGDTIALSITPT
YLQQIGLIDDIPDESNDIGMLLKVALDKIAFIPFGLMVDQWRWKVLAGETTPEQYNQLWW
ELREKYQGVAAPVERSANAFDPGAKYHVPANVSYTRYFLAHVLQFQFHKALCDIAGSEEA
LHRCSIYGSKEAGEALNNMLKMGKSRPWQEAMTTLTGSPDMDASTIEAYFAPLKVWLDKQ
NEERNCGW
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaagcaaactttcagtattggcatcaatcctgattgccctttgtgccggctgc
tcaccgagcaacacaagttcaacaaagcctcaagccctaacgctcgatgcagatgatgca
aaagcattcttgcaaaaagtagatgctgacatcactcgcttgaacaagccggcgtctcat
gctgcatgggcctacgcaactaacatcaactatgacaacgcgcaggttgatgcatatctg
ggcgagcaattgtcagtaatgtgggcgaagtacgctgtagaagcggctaagtttaatgac
gtagtcgtagatgcagatacgcgcaggcaactagatttgttgaaatcagggctagaaatt
gctcctccagcggaccctgctaaagcagaacgtttagccgcaattggctcagatttatcc
ggtatttatggcgcaggaaaatactgccgcagtgaaaacgaatgtttttctcttgttgaa
atgagtgcagaaatggcggtgagtcgcgatcccgctttgatgttagagttttggaaaggt
tggcgcgaggtgtctgtgcccatgaaagagatgtttgttgagcaagttggcatagcgaat
gaaggtgctgtggagttgggctatgccaatacatcggaattgtggcgcgctaaatacgac
atgccggcggaagctttcccaaaggagcttgaccgtttatggggccaaattcagccattc
tataactcattgcattgtcacgttagagctgagctatctgaacactacggtgaagaaatc
gtcccactagacaagccgattccagcgcatctgctcggcaatatgtgggcacaaagctgg
ggcaatatttacgaccttgtcaaacccgaacaagaaatgaacttacctgatgtgacaaaa
gcattagcagagcaaggatacgacgaaataaaaatggtgaaacaagctgagggcttcttt
tcttcactcggttttgctccactcccagatactttttatgaacgttcaatgttccaaaaa
ccggcagaacgcgacgttcagtgtcatgcatcggcgtgggatgtagatgaaaaagacgat
ttacgcattaaaatgtgtattcaaaaaaccggggaagagtttaacgttattcaccacgaa
ttaggccacaactattatcagcgtgcatataaagaccaaccgatgctgtatagaggttct
gccaacagtggcttccacgaagccattggcgacactattgctctgtctatcacaccgact
tatttgcagcaaattggtttgattgacgatattccagacgagtcaaatgacattggcatg
ctgttgaaagtggcgctggacaaaattgcctttatcccatttggtttaatggtagatcag
tggcgctggaaagtacttgcaggcgaaacgaccccagagcaatacaatcagctttggtgg
gagttgcgcgaaaaatatcaaggagtagcagcacccgttgagcgctctgctaacgctttc
gatccaggtgcgaagtatcatgttcctgctaacgtttcgtatacacgttacttcctagcg
catgtgctgcagtttcaatttcacaaagccctgtgcgacattgctggtagcgaggaagcc
ttacatcgttgctcaatttacggcagcaaagaagctggagaagcgctaaataacatgcta
aaaatgggtaaaagtcgaccttggcaggaagcaatgacaactttgacgggctcgcctgat
atggatgcctcaacgatagaagcttattttgcgccgttaaaggtatggctagacaagcaa
aacgaagaacgaaattgtggctggtaa

DBGET integrated database retrieval system