KEGG   Geodermatophilus obscurus: Gobs_2657Help
Entry
Gobs_2657         CDS       T01163                                 

Definition
(GenBank) conserved hypothetical protein
Organism
gob  Geodermatophilus obscurus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2470
Motif
Other DBs
NCBI-ProteinID: ADB75292
UniProt: D2S6B8
LinkDB All DBs
Position
2763840..2764574
Genome map
AA seq 244 aa AA seqDB search
MTTGPAAPTLRADAAERARTVAGRSPAALCVRGLGVGRPLAHATTTTGTTYVLVPTGGEV
DAALAGRDDLTAVLLRDPLRAQLWLSGWLTPVHPAARRAAVLAFAGTRPVAPLLDVGRGI
TLLRLDLAEVVLREGERCTEVGPQGYAAARPDPLAAVEARVLQHLDREHPQVLDLLRSRI
PAGDLGPRDVVRPLGLDRFGFRLRIERPAGRCDLRVPFPRPLTCPGQLQAATRQLICSAR
ASRG
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaccggccccgcagcgcccaccctccgcgccgacgccgccgagcgtgcccgcacc
gtcgccggccgcagccccgccgcgctgtgcgtgcgcgggctgggcgtcggccgcccgctg
gcgcacgcgaccaccaccacgggcacgacctacgtgctggtgcccaccggcggggaggtc
gacgccgcgctcgccgggcgggacgacctcaccgcggtgctgctgcgggacccgctgcgc
gcccagctgtggctctccggctggctcaccccggtgcaccccgccgcccggcgcgccgcg
gtgctcgccttcgccgggacccggccggtggcaccgctgctcgacgtcgggcggggcatc
acgctgctgcggctggacctggccgaggtggtgctgcgggagggggagcgctgcacggag
gtgggcccgcagggctacgccgcggcccggcccgacccgctggccgccgtcgaggcgcgg
gtgctgcagcacctcgaccgcgaacacccccaggtcctcgacctgctgcgcagccgcatc
ccggccggcgacctcggcccgcgcgacgtcgtccgccccctggggctggaccgcttcggc
ttccggctccgcatcgagcgcccggccggccggtgcgacctgcgggtgccgttcccgcgg
ccgctcacctgccccggccagctgcaggccgccacccggcagctgatctgcagcgcccgg
gcgtcccggggctag

DBGET integrated database retrieval system