KEGG   Gordonia sp. YC-JH1: CXX93_08620Help
Entry
CXX93_08620       CDS       T05256                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
goc  Gordonia sp. YC-JH1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AUH68402
LinkDB All DBs
Position
complement(1871502..1872449)
Genome map
AA seq 315 aa AA seqDB search
MGDEAVVLQVPGPDGSVRDVRVSSPDRVYFADAGLTKLDLARYYLAVADGITRALYERPC
MLHRFPRGTAEKKVHQKKLPAGAPDWVQTVDIFFPRYSRTVHELCVTEPAAVLWAVQMAT
VEFHPWNSRRSHVEQPDEWRIDLDPMPGADFARVRRVAHVVHEILDELGIRGFPKTSGGH
GLHVYVRIEPEWGFGDVRRAAHAFGAEVVRRLPGDATVTWWRKDRDPDAVFIDFNQNARD
HTMAAAYSIRANARATVSAPLRWDEIDDAEPDDFTVATMPARYAELGDLHRAIDDRAFRL
DPLLEWADRDGLAGE
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgggtgacgaagccgtcgtactgcaggttcccgggcccgacgggtcggttcgcgacgtg
cgggtgagcagccccgaccgtgtctatttcgccgatgccggactcacgaagctcgacctc
gcgaggtactacctggccgtcgcggacggcatcacccgcgctctgtacgaacggccgtgc
atgcttcaccgcttccctcgcgggacggcggagaagaaggtccaccagaagaagctccca
gccggtgcgcccgactgggtgcagaccgtcgacatcttcttcccccggtactcgcgcacc
gtccacgaactgtgcgtgaccgagcccgcggcggtgctctgggccgtacagatggcgact
gtcgagttccacccctggaactcgcggcgctcgcacgtcgaacagcccgacgagtggcgg
atcgacctcgatccgatgcccggcgcggacttcgcccgcgtccgccgggtggcgcacgtg
gtccacgagatactcgacgaactcggcatccgcggattcccgaagacgtccggcgggcac
ggactgcacgtctacgttcgcatcgaacccgagtggggattcggcgacgtgcgccgcgcc
gcacacgccttcggtgccgaagtggtgcgacggctgcccggcgacgccacggtgacgtgg
tggcgcaaggaccgcgatcccgacgccgtcttcatcgacttcaaccagaacgccagggat
cacacgatggccgccgcgtactcgatccgcgcgaacgcccgcgccacggtctcggcgccg
ctgcgctgggacgagatcgacgacgccgagccggacgacttcaccgtcgcgacgatgccc
gcccgctacgccgaactcggcgaccttcaccgcgcgatcgacgaccgcgcattccggctc
gaccccctgctggagtgggccgaccgagacggactcgccggcgagtag

DBGET integrated database retrieval system