KEGG   Gluconobacter oxydans H24: B932_1286Help
Entry
B932_1286         CDS       T02348                                 

Definition
(GenBank) SucA
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
goh  Gluconobacter oxydans H24
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:goh00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B932_1286
  Amino acid metabolism
   00310 Lysine degradation
    B932_1286
   00380 Tryptophan metabolism
    B932_1286
Enzymes [BR:goh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     B932_1286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1307703..1310351)
Genome map
AA seq 882 aa AA seqDB search
MGDHRDDRDAINGANTVYLAELHARWQDDPASVDPAFAALFETLGADRPSTTEASNSSAE
ALKNAYRLRGHSLAKLDPLGLAPTLTLPELNPPDADRDLLLRLRRAYSGTLTAEFMHIQD
VAQRQWWIDRLENTPPVVAMEPERILLALTRAEGFEGFCQKRFMGMRRFGLEGGESVIVA
LRTLIDAAARDGAKSVSLGMPHRGRLNVMANILRKPFAAIFSEFAGAPFKPDDIQGSGDV
KYHLGTATTMEHAGHTLRISLLPNPSHLEAVDPVVLGRVRADQDREKDKDRDRHLGILVH
GDAAFAGQGVVYETLALSRLEGYRTGGTVHVIINNQIGFTTVQSDAHSGIHNTDIAKSIQ
APILHVNGDDPDAVARAALLAHEWRRDFHSDVVLDVVCYRRHGHNETDEPAFTQPAMVHA
IQSRPTTRRLYADHLIRKGLLTAAQVEDMWQHFQRRLEEQYAASEHYRPNATDWLDGPQD
STRLQDEPERIQPMTGVPLDRLRMVGEAIGTIPQGLNVHPRLARQIIARGKAVANGGPLD
WATAEALAFGTLSMDGHPVRLSGQDSRRGTFSQRHAVLFDQDTGREETLLAHIAPHQAPL
HLWNSPLSEFAVLGFEYGYSLGDPDALVLWEAQFGDFANGAQVILDQFIASGETKWLRTS
GLTLLLPHGYEGGGPEHSSARPERILQLCAENNLRVCNITSPANYFHALRRQIARRCRKP
LVIFTPKSLLRHKEATSPLTEMGPHTRFQPVLADSQQITHARKIILCSGKVFYDLTAERA
RQNRTDVAIIRLEQLYPFPHHALIQQLELYPDAEQIIWCQEEPQNNGAWIFVDRRIERAL
QECGHTVQRPQYVGRESAASPATGLPGAHTAQQEKLIRDALA
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atgggcgatcaccgcgacgaccgcgatgccatcaacggcgccaacaccgtctatctggcc
gagcttcatgctcgctggcaggacgaccccgcctccgttgatccagctttcgccgctctt
ttcgaaacactcggcgccgatcgcccctcaacgacggaagcctcgaatagcagcgccgaa
gccctgaaaaatgcctaccgtctgcgcggccactccctcgccaaacttgatccgctgggc
ctggccccaactctgacactcccagaacttaatccccctgatgccgaccgcgatctcctg
ctccgtttgcgtcgcgcctattccggcaccctgaccgcagaattcatgcacattcaggac
gtggctcaacggcagtggtggattgatcgcctcgagaacaccccacccgtcgtcgccatg
gaaccggaacgcattctgctcgccctgacacgcgccgaaggattcgaaggcttctgccaa
aaacgcttcatgggaatgcgccgcttcggtctggaagggggagaaagcgttatcgtcgcc
ctccgcaccctgatcgacgccgccgcgcgggacggcgcaaagtcagtctcgctcggcatg
ccacatcgtggccgcctgaacgtcatggccaacatcctgcgcaaacccttcgcggccatt
ttcagcgaatttgcaggcgcgcccttcaagcctgacgacattcagggctccggagacgtc
aaataccatctcggcacagccactacgatggaacacgcaggtcataccctgcgcatctcc
ctgctgcccaacccatcccatctggaagccgtcgatcccgtcgtcctcggacgcgtccgc
gccgatcaggaccgcgaaaaggacaaggaccgcgaccgccatctaggcattctcgttcac
ggtgacgccgccttcgccgggcaaggcgtcgtgtacgaaaccctcgcactctccaggctc
gaaggctaccgcaccggcggcacggtgcacgtcatcatcaacaaccagattggcttcacc
accgtccagtcagacgcgcattccggtatccacaacacggacatcgccaaatccattcag
gcccccatcctgcatgtgaatggtgacgatcctgatgccgtcgcccgggccgctcttctg
gcccatgaatggcgccgcgatttccattcagatgtcgttctcgacgtcgtctgctatcgc
cgccacgggcacaatgaaaccgatgaaccggctttcacccagccagccatggttcacgcc
atccagtcccgaccaaccacccgccgcctctacgccgaccatctgatccgcaaaggtctc
ctgacagccgcgcaggtcgaagacatgtggcaacacttccagcgcagactggaagagcaa
tacgccgcctctgaacactaccgcccgaacgcaacagattggctggatggcccgcaggac
tccacgcgccttcaggatgagccggaacgcatccagcccatgaccggcgtccccctcgat
cgtcttcggatggttggtgaagccatcggcaccatcccgcagggcctgaacgtacacccg
cgcctcgcacgtcagatcattgcccgcggcaaggctgtggctaatggcggcccgcttgac
tgggccacagccgaagctcttgctttcggaaccctgtcaatggacgggcacccagtccgt
ctttcaggtcaggacagtcgccgcggaacattcagccagcgtcacgccgtcctgttcgat
caggacaccggccgggaagaaacccttctggcccatatcgctccccatcaggcccctctg
catctctggaactctccgctctctgaatttgccgtcctcggcttcgaatacggctattca
ctcggtgatccggatgcgctggttctgtgggaggctcaatttggcgacttcgcaaacggt
gcacaggtcattcttgaccagttcatcgcttccggcgaaacaaaatggctccgaacatcc
ggcctgacgctcctgctgccacacggctacgagggcggtggccctgagcactcgtcagcc
agaccagaacgtattctccagctctgcgcagaaaacaatctgcgtgtctgtaacatcacc
agcccggcaaactattttcatgccctgcgccgccagattgcacgacgttgccgcaagcca
ctggtcatcttcacacccaagtctctgctgagacacaaggaagcgacctctcccctcact
gaaatggggccacacacgcgcttccagcccgttctggcagattcacagcagattacacac
gccagaaagatcatcctgtgctcaggcaaggttttctacgacctaaccgccgagcgggcc
cgacagaaccgcacagacgtcgccatcatccgtctggagcaactttatcccttcccgcac
cacgcgctgatccagcaactggaattgtacccggacgctgaacagatcatctggtgtcag
gaagaaccccagaacaacggtgcctggatttttgtggaccgacgcatcgaacgcgctcta
caggaatgtggacacacagttcagcgcccgcagtatgtaggccgcgaaagcgccgcttca
cccgcaacaggcctaccgggtgcgcacaccgcccaacaggaaaaactgattcgagacgca
ctggcctga

DBGET integrated database retrieval system