KEGG   Gordonia sp. QH-11: ACH46_10045Help
Entry
ACH46_10045       CDS       T04097                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
goq  Gordonia sp. QH-11
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:goq00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ACH46_10045
  Energy metabolism
   00680 Methane metabolism
    ACH46_10045
Enzymes [BR:goq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     ACH46_10045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2133255..2136113
Genome map
AA seq 952 aa AA seqDB search
MAATGSTPDTPNPAAIEQAIATPMVERISVDDTGRVLTEPLRDDIRYLGGLLGDVIRAHA
GEETFRLVEDSRQDAFGIRYADRTRDDLAARYVGRGVSDLMPVIRAFTNFALLANLAEDL
HRERRRRIHLRAGDPAQPSSLAGAFAKLADAGLSDAEVAAALVDAEVVPVITAHPTETRR
RSVFDAQNRITELMRIRSRTELTPAEEAALSADIGRQILLLWQTALIRLRRLTISDEIVT
GLRYYGASFFDVVPALNNDVRAALAEAYPDADFGGMSMISMGSWIGGDRDGNPFVTAEVV
TEASSSAARAVMRYHLDQLTTLHQELSLSARLFRPVTEALTELGAHHVPAGEPVDGDDEP
FRSAVTAVRSRVLARALVTLGEDVIDPAERDIAASSVPYDDADEFLADLDVIDEALRAGS
DASIADDRLAALREAVRTFGFHLSGLDMRQNSETHEEVVAELLAWAGVCDDYAALDEPAR
VELLSRELTSRRPLTSPDADLSDLAIKELGVVHAAAGAVDRFGPRAVPNYIISMCTSVSD
MLEALLFLKEAGLYVPGATPSCSVRVVPLFETIEDLRDGAATLTATLGLDFYRDLVRAQG
NTQEVMLGYSDSNKDGGYLAANWALYRAELDLVKAAREADVRLQLFHGRGGTVGRGGGPS
YDAILAQPPGAVQGALRLTEQGEIIAAKYAEPVSARRNLESLLAATIESTLLDTEGLGDD
PAEAYADFDELAELARRAYSALVHETPGFVEYFTASTPLSEIGALNIGSRPTSRKQTTAI
TDLRAIPWVLSWTQCRVMLPGWYGVGSAVQEWIGADERRLAKLQDYYENWPFFRSVMSNM
AQVLAKSDMGLAHRYAQLVDDEDLRERVFTMIVAEHERTIAMYTKIAGTSDLLADNAALK
RSVYNRFPYLEPLNLMQVELLKRFRSGEDSPLIRRAIQLTMNGLATALRNSG
NT seq 2859 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaccggctcgacccccgacaccccgaatcccgccgcgatcgagcaggcgatc
gcgacgccgatggtcgaacgcatcagcgtcgacgacaccggtcgggtcctgaccgaaccg
ctccgtgacgacatccgctatctgggcgggctcctcggcgacgtgatccgggcgcatgcg
ggggaggagaccttccgactggtcgaggactcccgccaagacgccttcggcatccgttac
gcggaccggacgcgcgacgacctcgccgctcgctacgtcggccgcggtgtgtcggacctg
atgccggtgatccgcgcgttcaccaacttcgcgctgctcgccaacctcgccgaggacctg
caccgggaacgtcggcggcgcatccatctgcgggcgggcgatccggctcagccgtcgtcg
ctggcgggtgcgttcgcgaaactcgccgacgccggcctctccgacgccgaggtggctgcc
gcactggtcgacgcggaggtggtcccggtgatcaccgcgcatcccacggagacgcgtcgc
cggagcgtgttcgacgcccagaaccggatcaccgagctgatgcgcatccgttcccgcacc
gagctgacaccggccgaggaggccgccctgtcggccgacatcggcaggcagatcctgctg
ctgtggcagacggcgctgatccgcctgcggcgcctgaccatctccgacgagatcgtgacg
gggctgcggtactacggcgcctccttcttcgacgtggtgcccgccctcaacaacgacgtc
cgggcggccctcgccgaggcctacccggacgccgacttcggcggtatgtcgatgatcagc
atgggctcctggatcggcggcgaccgcgacggcaacccgttcgtcaccgccgaagtggtg
accgaggcgtcgtcgagcgcggcgcgcgccgtgatgaggtatcacctggatcagttgacg
acgctgcaccaggaactgagcctgtccgcgcggctgttccgaccggtgaccgaggcgctg
accgagctcggcgcacatcacgtgccggcaggcgaaccggtcgacggcgacgatgagccg
ttccggtccgcggtcaccgccgtgcgatcccgagtgctcgcacgggcactggtgacgctc
ggcgaggacgtgatcgaccccgccgaacgggacatcgcggcgtcgtctgtgccgtacgac
gacgccgacgagttcctcgccgacctcgacgtgatcgacgaggccctgcgcgcgggctcc
gacgcatccatcgcggacgaccggctcgccgcactccgcgaagcggtccgcaccttcggc
ttccacctgtccggcctcgacatgcggcagaactccgagacccacgaggaggtggtcgcc
gaactgctcgcgtgggcgggcgtctgcgacgactacgcggcgctcgacgaaccggcgcga
gtcgagttgctcagccgcgaactcacgtcgcggcgtccgctgacgtcacccgacgccgac
ttgagcgacctcgcgatcaaggagctcggtgtggtccacgcggcggccggcgccgtcgac
cgcttcgggccccgggccgtgcccaactacatcatcagcatgtgcacctcggtgtcggac
atgctcgaggcgctgctgttcctcaaggaggccgggctctacgtgccgggcgcgactccg
tcgtgcagtgtccgggtcgtcccgctgttcgagaccatcgaggacctgcgcgacggcgcg
gcgaccctcacggcgaccctcgggctcgacttctaccgcgatctggtccgcgcgcaggga
aacacccaggaggtgatgctcgggtactcggactccaacaaggacggcggatacctggcg
gccaattgggcgctctaccgtgcggagttggatctggtgaaggccgctcgcgaggcggac
gtgcggctgcaactgttccacggacgcggcggcaccgtcggtcgcggcggcggccccagc
tacgacgcgatcctcgcacagccgcccggcgcggtacagggtgcgctgcggctcaccgaa
cagggtgagatcatcgccgccaagtacgccgagcccgtcagcgcccgccgcaacctggag
tcgctgctggccgccaccatcgagtcgaccctgctggacaccgagggactcggcgacgat
cccgccgaggcttacgccgacttcgacgagctcgccgaactggcccgtcgggcgtacagc
gctctggtgcacgagacgcccggcttcgtcgagtacttcaccgcgtcgaccccgctctcg
gagatcggtgcgctcaacatcggcagccgaccgacgtcgcggaagcagacgaccgccatc
accgatctgcgggcgattccgtgggtgctgtcctggacgcagtgccgcgtcatgctcccc
ggctggtacggagtcggcagcgccgtgcaggagtggatcggcgccgatgagcgtcgcctc
gcgaaactgcaggactactacgagaactggccgttcttccgatcggtgatgtcgaacatg
gcgcaggtgctcgcgaagtccgacatgggcctggcacaccgctacgcacaactcgtcgac
gacgaggacctccgcgagcgggtgttcacgatgatcgtcgccgagcacgagcggaccatc
gcgatgtacacgaagatcgcaggcacctccgatctcctcgccgacaacgcagccctgaaa
cggtcggtctacaaccggttcccgtatctggagccgctgaacctgatgcaggtggagctg
ctcaagcggttccgttcgggggaggactcgccgctgatccggcgtgccatccagctcacg
atgaacggtctggcgacggcgttgcgcaacagcggatag

DBGET integrated database retrieval system