KEGG   Gordonia sp. KTR9: KTR9_3313Help
Entry
KTR9_3313         CDS       T02216                                 

Definition
(GenBank) putative eukaryotic-type DNA primase
Organism
gor  Gordonia sp. KTR9
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AFR49948
UniProt: J9SN86
LinkDB All DBs
Position
3805266..3806255
Genome map
AA seq 329 aa AA seqDB search
MTVMAKTSASAGDPIELEVGDRTVRLSSPDRVYFPERGETKRDLAEYYLSVGDGIVRALR
DRPCMLHRFPKGVSGNKVHQKRVPAGAPDWLETTEIYFPRFGRTADELCVTELASVIWAV
QMSTVEFHPWNSRRADPETPDEWRIDLDPMPECTFPRVRRVAHVVEEVLDELGMRGFPKT
SGGRGLHIYVRIAPEWGFPQVRRAALAFAREVERRAPDDVTTTWWRKDRDPAAVFVDYNQ
NTRDHTMASAYSVRGNERATVSTPITWAEIDDIEPDDFTIATVPARFAELGDLHGEIDDV
AHRLDTLIDWADRDDIGDDEGAEVIDMDR
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
gtgacggtcatggcgaaaacgtcggcttccgcaggtgatcccatcgaactcgaggtcggc
gaccgcaccgtccggttgtcgagcccggaccgcgtctactttcccgagcgcggcgagacc
aagcgcgatctcgccgagtactacctgtccgtgggcgacgggatcgtgcgcgccctgcgc
gaccgcccgtgcatgctgcaccggtttcccaagggcgtcagcggcaacaaggtgcaccag
aaacgcgtcccggccggcgcccccgactggctggagaccaccgagatctacttcccgcgg
ttcggccgcaccgccgacgaactgtgcgtcaccgaattggcgtcggtgatctgggcggtg
cagatgtcgaccgtggagttccacccctggaactcgcgtcgcgccgatcccgagaccccc
gatgaatggcgaatcgacctcgacccgatgcccgagtgcacgtttccgcgggttcgccgc
gtggcgcacgtcgtcgaagaggtgctcgacgagctgggcatgcgcgggttcccgaagacc
tcgggtggtcgaggcctgcacatctatgtccgcatcgcaccggaatggggcttcccccag
gtccgacgcgcggcgctggcgttcgcgcgggaggtcgagcgccgggcgcccgacgacgtg
acgacgacgtggtggcgcaaggaccgtgaccccgccgcggtcttcgtcgactacaaccag
aacacccgcgaccacacgatggcctcggcctactccgtgcgcggcaacgagcgagccacc
gtgtcgacaccgatcacctgggccgagatcgacgacatcgaacccgacgacttcacgatc
gccaccgtgccggcccgcttcgccgaactcggggacctccacggcgagatcgacgacgtc
gcccaccgcctcgacacgctcatcgactgggccgaccgtgacgacatcggcgacgacgag
ggcgccgaggtcatcgatatggatcggtga

DBGET integrated database retrieval system