KEGG   Gemella sp. oral taxon 928: AXE85_07640Help
Entry
AXE85_07640       CDS       T04256                                 

Definition
(GenBank) iron ABC transporter ATP-binding protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
got  Gemella sp. oral taxon 928
Pathway
got00010  Glycolysis / Gluconeogenesis
got00020  Citrate cycle (TCA cycle)
got00620  Pyruvate metabolism
got01100  Metabolic pathways
got01110  Biosynthesis of secondary metabolites
got01120  Microbial metabolism in diverse environments
got01130  Biosynthesis of antibiotics
got01200  Carbon metabolism
Module
got_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:got00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AXE85_07640
   00020 Citrate cycle (TCA cycle)
    AXE85_07640
   00620 Pyruvate metabolism
    AXE85_07640
Enzymes [BR:got01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AXE85_07640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 PYNP_C QRPTase_N
Motif
Other DBs
NCBI-ProteinID: AME10025
UniProt: A0A0X8KMT1
LinkDB All DBs
Position
complement(1650707..1652098)
Genome map
AA seq 463 aa AA seqDB search
MAVEVIMPKAGSEMEEGEIVQWFKKEGDHVEAGEVLLEIVTDKVNMEVEADASGTLLKIL
AQAGDVVPVVQTIAWIGEKGEEIPGASATGEVAPAETIVEKKVDVTPVKEIEKIDYSGLR
ATPAARAYAREKGIDLAKVKGTGAKGRIHKEDVLEYKLNSKVKISPLAERIAEIEGVSTT
GIVGTGPNGKIMKADVLAVLHGTPKAAPVKKEEVAPAKAKKAPLAPNENQWGVVETVPMS
PMRKVISKRMSESYFSAPTFVVNVEVDMTELLALRKKVVDTIIEETGKKATVTDFISLAV
IKSLMKHPYVNASLSKDEKEMYLHHYVNLSIAVGMDSGLVVPVIKGADKMSLKELVVASK
EITTKALNGKLKPDEMADSTFTISNLGMYGVKSFVPIINQPNTAILGVSATVPKPVVMNG
EIVVRPIMTLTLTADHRVVDGLEGAKFMKTLKEAIENPLSLLI
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggcagtagaggttattatgccaaaagccggcagtgaaatggaagagggcgaaatcgta
caatggtttaaaaaagaaggagatcatgtagaagcaggagaagtcctattagaaatcgtc
actgataaagtaaatatggaagtagaagctgacgctagcggtacacttttaaaaatattg
gcacaagctggggatgtagtccctgtggtacaaactatcgcatggataggggaaaaagga
gaagaaattcccggagcaagtgcaacaggagaggtagcaccagcggaaacaatagtagag
aaaaaagttgatgtgacgccggttaaggaaatagaaaaaatagattattcaggattgcgt
gcaacacctgcggcaagagcgtatgcacgtgaaaaaggaattgatttagcaaaagttaaa
ggaacaggtgctaaaggacgtattcacaaagaagatgtacttgaatataaacttaacagc
aaggtgaaaatttctccgttagcagaacgtattgctgaaattgagggagttagtacaaca
ggtattgtcggtacgggaccaaacggtaagattatgaaagcagatgtgcttgcagtgctt
catggtacaccgaaagcggcaccggtgaaaaaagaagaggtagcaccggcaaaagctaaa
aaagcgccgcttgcacctaatgaaaatcaatggggcgttgttgaaacggtacctatgtcg
ccgatgcgtaaagttatttctaaacgtatgagtgaatcatatttcagcgcaccgactttt
gtagttaatgttgaagtggatatgacggaactattagcattacgtaaaaaagttgttgat
acaatcatagaagaaacaggtaaaaaagcaacggtaactgactttatttcattagcagtt
attaaatcattgatgaaacatccgtatgtaaatgcttcattatcaaaagatgagaaagag
atgtatctacatcattatgtaaacttatcaatagctgtaggtatggacagcggattagtg
gtaccggtaattaaaggtgcagataaaatgagtcttaaagagttagtggtagcttctaaa
gaaattacaacaaaagctcttaacggaaaattaaaaccggacgaaatggctgattcaaca
tttacaatcagtaatttaggtatgtacggtgttaaaagttttgtacctattataaaccaa
cctaatacagcaattttaggtgttagtgcaactgtaccgaaaccggttgtaatgaacggc
gaaatagttgtaagaccgattatgactcttaccttaacagcagatcaccgtgtagtagac
ggattagagggggctaaattcatgaagacattgaaagaagctattgaaaatccactatca
ttactaatctaa

DBGET integrated database retrieval system