KEGG   Gemella sp. oral taxon 928: AXE85_07640Help
Entry
AXE85_07640       CDS       T04256                                 

Definition
(GenBank) iron ABC transporter ATP-binding protein
  KO
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
got  Gemella sp. oral taxon 928
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:got00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AXE85_07640
   00020 Citrate cycle (TCA cycle)
    AXE85_07640
   00620 Pyruvate metabolism
    AXE85_07640
Enzymes [BR:got01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AXE85_07640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1650707..1652098)
Genome map
AA seq 463 aa AA seqDB search
MAVEVIMPKAGSEMEEGEIVQWFKKEGDHVEAGEVLLEIVTDKVNMEVEADASGTLLKIL
AQAGDVVPVVQTIAWIGEKGEEIPGASATGEVAPAETIVEKKVDVTPVKEIEKIDYSGLR
ATPAARAYAREKGIDLAKVKGTGAKGRIHKEDVLEYKLNSKVKISPLAERIAEIEGVSTT
GIVGTGPNGKIMKADVLAVLHGTPKAAPVKKEEVAPAKAKKAPLAPNENQWGVVETVPMS
PMRKVISKRMSESYFSAPTFVVNVEVDMTELLALRKKVVDTIIEETGKKATVTDFISLAV
IKSLMKHPYVNASLSKDEKEMYLHHYVNLSIAVGMDSGLVVPVIKGADKMSLKELVVASK
EITTKALNGKLKPDEMADSTFTISNLGMYGVKSFVPIINQPNTAILGVSATVPKPVVMNG
EIVVRPIMTLTLTADHRVVDGLEGAKFMKTLKEAIENPLSLLI
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggcagtagaggttattatgccaaaagccggcagtgaaatggaagagggcgaaatcgta
caatggtttaaaaaagaaggagatcatgtagaagcaggagaagtcctattagaaatcgtc
actgataaagtaaatatggaagtagaagctgacgctagcggtacacttttaaaaatattg
gcacaagctggggatgtagtccctgtggtacaaactatcgcatggataggggaaaaagga
gaagaaattcccggagcaagtgcaacaggagaggtagcaccagcggaaacaatagtagag
aaaaaagttgatgtgacgccggttaaggaaatagaaaaaatagattattcaggattgcgt
gcaacacctgcggcaagagcgtatgcacgtgaaaaaggaattgatttagcaaaagttaaa
ggaacaggtgctaaaggacgtattcacaaagaagatgtacttgaatataaacttaacagc
aaggtgaaaatttctccgttagcagaacgtattgctgaaattgagggagttagtacaaca
ggtattgtcggtacgggaccaaacggtaagattatgaaagcagatgtgcttgcagtgctt
catggtacaccgaaagcggcaccggtgaaaaaagaagaggtagcaccggcaaaagctaaa
aaagcgccgcttgcacctaatgaaaatcaatggggcgttgttgaaacggtacctatgtcg
ccgatgcgtaaagttatttctaaacgtatgagtgaatcatatttcagcgcaccgactttt
gtagttaatgttgaagtggatatgacggaactattagcattacgtaaaaaagttgttgat
acaatcatagaagaaacaggtaaaaaagcaacggtaactgactttatttcattagcagtt
attaaatcattgatgaaacatccgtatgtaaatgcttcattatcaaaagatgagaaagag
atgtatctacatcattatgtaaacttatcaatagctgtaggtatggacagcggattagtg
gtaccggtaattaaaggtgcagataaaatgagtcttaaagagttagtggtagcttctaaa
gaaattacaacaaaagctcttaacggaaaattaaaaccggacgaaatggctgattcaaca
tttacaatcagtaatttaggtatgtacggtgttaaaagttttgtacctattataaaccaa
cctaatacagcaattttaggtgttagtgcaactgtaccgaaaccggttgtaatgaacggc
gaaatagttgtaagaccgattatgactcttaccttaacagcagatcaccgtgtagtagac
ggattagagggggctaaattcatgaagacattgaaagaagctattgaaaatccactatca
ttactaatctaa

DBGET integrated database retrieval system