KEGG   Gluconobacter oxydans 621H: GOX0161Help
Entry
GOX0161           CDS       T00230                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
gox  Gluconobacter oxydans 621H
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gox00001]
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    GOX0161
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    GOX0161
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    GOX0161
Enzymes [BR:gox01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     GOX0161
Peptidoglycan biosynthesis and degradation proteins [BR:gox01011]
 Precursor biosynthesis
  Amino acid ligase
   GOX0161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
177613..178524
Genome map
AA seq 303 aa AA seqDB search
MKVAVLLGGTSSERPVSLVSGEAAIEALREKGHDVTPIDVGPDIATTIASLKAAAPDVVF
NALHGPRGEDGAIQGVLEWLGLPYTHSGIRASAVAMDKGATRILLAAAGLPVAQGRVVTV
EELAEADPLPAPYVIKPVAEGSSVGVEIVRTGDNRRAEIARTWRFGKEALVESFIPGREL
TAGVMGDRALAVTDILPSETAAFYDFEAKYKAGGSRHVVPAELPQAVTDRALDYALRAHQ
TLGCQGASRTDFRYDEGTDTLVILEVNTQPGMTPTSLLPEQAAYCGISYPELCDWMVREA
LAR
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcgcagtcctgttggggggaacatccagtgagcggcctgtcagtctcgtcagt
ggcgaggccgcaatcgaggccctgcgcgaaaagggacacgacgtcaccccgatcgatgtc
ggaccggatatcgcaacgaccatcgccagcctgaaagccgccgcaccggacgtcgttttc
aacgccctgcacggcccccgtggcgaagacggtgccattcagggcgttctggaatggctt
ggcctgccctacacccattccggcatccgcgcctcggccgtggcaatggacaaaggcgca
acccgcatccttctggccgccgccggtctgcccgtggcgcaaggacgtgtcgtgacggtt
gaagagctggccgaagccgatccgctccccgcaccctatgtcatcaagccggtcgcagaa
ggttcctccgtcggtgtcgagatcgtgcggacgggagacaaccgtcgcgccgaaatcgcg
cggacttggcgtttcgggaaagaggcattggtcgagagcttcattcccggtcgcgagctg
accgcaggcgttatgggcgaccgggctctggccgttacggacatcctgcccagcgaaacg
gctgcgttttatgatttcgaggccaaatacaaggctggcggctcacggcacgtggtccct
gcggagcttccgcaggcggtgacagaccgtgcgcttgattacgccctgcgcgcccatcag
acactgggctgtcagggggccagccgcacggatttccgctacgatgagggcaccgacacg
ctggtcatcctcgaggtcaacacacagcccggcatgacaccgacatccctgctgccggaa
caggccgcctattgcgggatttcctatccggaactgtgtgactggatggtccgggaggca
ctggcgcgctga

DBGET integrated database retrieval system