KEGG   Gluconobacter oxydans 621H: GOX0382Help
Entry
GOX0382           CDS       T00230                                 

Definition
(GenBank) Protein Translation Elongation Factor Tu (EF-TU)
  KO
K02358  
elongation factor Tu
Organism
gox  Gluconobacter oxydans 621H
Brite
Translation factors [BR:gox03012]
 Eukaryotic Type
  Elongation factors
   GOX0382
 Prokaryotic Type
   GOX0382
Mitochondrial biogenesis [BR:gox03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    GOX0382
Exosome [BR:gox04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   GOX0382
  Exosomal proteins of breast cancer cells
   GOX0382
  Exosomal proteins of colorectal cancer cells
   GOX0382
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(394950..396140)
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHCNIGTIGHVDHGKTSLTAAITKVLAKTGGATYSAYDQIDKAPEERARG
ITISTAHVEYETADRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPALVVFLNKVDQVDDPELLELVEMEVRELLSSYQFPGDDIPIVKGSALVTLE
DGDPSIGEDRVLELMTQVDAYIPQPERPVDRPFLMPIEDVFSISGRGTVVTGRVERGVVN
VGDEVEIVGLKDTVKTTVTGVEMFRKLLDRGEAGDNIGALVRGTKREDVERGQVLAKPGS
ITPHKKFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGVVTLPEGTEMVMPGDNVA
MDVELIAPIAMDEGLRFAIREGGRTVGAGVVSSITA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggctaaattcgagcggacgaagccgcactgcaacatcggcaccatcggtcac
gtcgatcacggcaagacctcgctgactgctgcaatcaccaaggtgctggctaagaccggc
ggcgccacctacagcgcgtacgaccagatcgacaaggctccggaagagcgcgcccgtggt
atcaccatttccacagctcacgttgagtacgagacggctgaccgtcactacgctcacgtc
gactgcccgggccatgctgactatgtgaagaacatgatcacgggtgcagctcagatggac
ggcgcgatcctcgtcgtgtccgctgctgatggtccgatgccgcagacccgcgagcacatc
ctgcttgcccgtcaggttggtgtgccggcactggtcgtgttcctgaacaaggttgaccag
gttgacgatccggagctgcttgagctcgtggaaatggaagttcgtgagcttctgtcttcc
taccagttcccgggcgacgatatccccatcgtcaagggctccgctcttgtgacgctggaa
gatggcgatccgtccatcggtgaagaccgcgttctcgaactgatgacgcaggttgacgcc
tacatcccgcagccggagcgtccggttgaccgtccgttcctgatgccgatcgaagacgtg
ttctcgatctcgggtcgtggtacggttgtcacgggtcgtgtcgagcgcggcgttgtcaac
gtgggtgacgaagtcgaaatcgtcggcctgaaggacaccgtcaagacgaccgttacgggc
gtcgagatgttccgcaagctgctcgatcgcggtgaagccggtgacaacatcggtgcgctg
gttcgtggcacgaagcgtgaagacgtcgagcgtggccaggttctggcaaagcccggctcc
atcacgccgcacaagaagttcaaggctgaggcttacatcctcacgaaggaagagggtggc
cgtcacacgccgttcttcacgaactaccgcccgcagttctatttccgtacgaccgacgtc
acgggcgtcgtgacgctgccggaaggcacggaaatggtcatgccgggtgacaacgttgcc
atggacgtggagctgatcgctccgatcgccatggacgaaggcctgcgcttcgctatccgc
gaaggtggccgtaccgtgggtgccggtgtggtttcttccatcaccgcctaa

DBGET integrated database retrieval system