KEGG   Gluconobacter oxydans DSM 3504: GLS_c12820Help
Entry
GLS_c12820        CDS       T03563                                 

Gene name
alr1
Definition
(GenBank) alanine racemase Alr
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
goy  Gluconobacter oxydans DSM 3504
Pathway
goy00473  D-Alanine metabolism
goy01100  Metabolic pathways
goy01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:goy00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    GLS_c12820 (alr1)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    GLS_c12820 (alr1)
Enzymes [BR:goy01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     GLS_c12820 (alr1)
Peptidoglycan biosynthesis and degradation proteins [BR:goy01011]
 Precursor biosynthesis
  Racemase
   GLS_c12820 (alr1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AHK71179
UniProt: A0A067Z4I6
LinkDB All DBs
Position
1457563..1458714
Genome map
AA seq 383 aa AA seqDB search
MMSACPDPLWPSYRAGARLTVDLDAIASNYRYLQTLASGASCAAVVKADAYGLGIERVAP
VLENAGATDFFVAHVDEGIRLRSVVSDKARITVLHGPRPGASGDCVRYGLRPVLNSLEQI
ALWRDEGSWTGGLPEAALQVDSGMLRFGLSDADLETLQADKGLVDGLHVGLVMSHLACAD
TPDHPANQAQKDRLLQMSARLPPAPLSLSASSGIFLGTDYHLDVVRPGAALYGIAPNRTG
PNPLSPVVRLQAHVLQIREILPGEGVGYGLTYRPDRVRRIATVAVGYADGFSRHGAGQGC
AWFEDIRLPILGRVSMDSLIVDISEVPEGKLGPDMMVDLIGPRRSVDDVAEAAGTIGYEV
LTSLGHRFHREYVGNQENPSRGD
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgatgagcgcatgtcctgatcctctgtggccttcctatcgtgccggtgcccgcctgacg
gtggatctggacgcgattgcttccaattaccggtatcttcagacgctggcctcaggcgct
tcgtgtgcggcggtcgtcaaggcggatgcctacgggctgggaatcgagcgggttgccccg
gttctggagaatgccggagccacggatttctttgtcgcgcatgtcgatgagggcatcagg
ctgcggtccgttgtgtcggacaaggcccggattacggtgctgcatggaccgcgccccggg
gcgtctggagactgcgtgcgctatggtctgcggcctgtcctgaacagtcttgagcagatt
gcgctgtggcgcgacgagggctcgtggacaggcgggctcccagaagcggcgcttcaggtt
gatagcgggatgttacggttcggtctctctgacgccgatcttgaaacccttcaggcggat
aaggggcttgtggacgggctgcacgtcggtcttgtcatgagccatctggcctgtgccgat
acgcccgatcatcctgccaatcaggcccagaaagaccggttgttgcagatgtccgcgcgg
ctgccgcctgcgccgctcagtctgtctgcgtcgtcggggatttttctggggacggactat
catctggatgtcgtgcgaccgggtgccgcactgtatggaattgcacccaaccggactggc
cccaatccgctgtcgccggtggtccggcttcaggcccatgttctgcagatccgtgagatt
ttgccaggtgagggggttggctacggcctgacctatcggcctgaccgcgtgcgccggatt
gcgacggtggctgtcgggtatgcggatggtttttcccggcatggcgccgggcagggctgt
gcgtggttcgaggatatccgtctgccgattctggggcgagtctcgatggattccctgatc
gtggatatttcagaggtgccggaaggaaaacttggtcccgacatgatggtggatctgatc
gggcccagacgcagtgtcgatgatgtcgcggaagcggcgggaacgatcggatacgaggtc
ctgacgtctctggggcaccgttttcatcgggaatatgttggaaatcaggagaacccctca
cggggcgattga

DBGET integrated database retrieval system