KEGG   Gamma proteobacterium HdN1: HDN1F_15120Help
Entry
HDN1F_15120       CDS       T01300                                 

Definition
(GenBank) Non-ribosomal peptide synthetase modules and related proteins
Organism
gpb  Gamma proteobacterium HdN1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding Condensation PP-binding AMP-binding_C Chorein_N
Motif
Other DBs
NCBI-ProteinID: CBL45095
UniProt: E1VJV3
LinkDB All DBs
Position
1876661..1885294
Genome map
AA seq 2877 aa AA seqDB search
MSRLVMNAVDLSQMNTLVGLLEARAAAHPDKLAYTFLPDGEEAGVDITYGELATRARAVA
ATLLTKGAAGDRALMLFPSSLEFVVGFFGCLYAGIAAVPAYPPRRNQNLGRLQSIIDDCE
PSIVMTTSKVMTVAAPIFEETPGLSHLQWACVDEISNEAAATWSAPAISAATIAFLQYTS
GSTGNPKGVMVSHGNLLANEAMITTAFESQENDLVVSWLPLFHDMGLIGTTLQPLYIGSR
AVFMSPASFLQKPVRWLQAVSDYKGTGICAPNFAYELCARQITPEQRATLDLSTLRVALS
GAEVVRPETIDLFCDTFAECGFKRSSFLPTFGLAEATLFVAGACKETRPLFKRVLADDLS
QNRVVLANADAGEKTLTLVSNGKSTLDGRVAIVDPNTFAVLPAGEVGEIWAAGPHIAQGY
WKREEATKETFAGYTADGDGPFMRTGDLGCMLDGELYITGRQKEVIIIRGRNHYPQDIEY
TVQQSHVALRGDAGAAFTVEINGEERLVVVQEVERKYRLTLNTEVVAAAVRQAVAETHEL
QVHTVVFIRPGSILKTSSGKIQRGANRKAFLENALEVISVSAPQEQSESSKNAIEDALKL
EKQQWLQLPAEEQEPRLVLYLKAMIAREISESLEKIKDDRSLMALGIDSLQITQLFTRLR
DKFEIDLELPALFEAEDFVALARTIANALRGERRAQLPPLERVDRETWMPLSFSQKRMWF
LDKLRENNIAYNLPFALKTQGALDIQAAEKAFESMVTRHEVLRTRYIQKDGYAWQVIEPP
SAWKFETIDLSYLKEPALGKAIQDHVYREARKPFNLEKGPVIRTQLLRLPDLVLEGHENS
RAGEQNLLLITMHHIAADGFSLKVITDEISRAYEAELNDTPLALPDLPIQYADFAHWQKH
LFESGLLDKQLHYWTEKLSGVPVLDFPTDRPRPPEQSFAGANHYFTIDKDRTAKLRQLSR
SQGVTLYMTLLSGFKTLLHLYTNSADICVGTPIANRTTPELEKLIGFFVNTLGLRTDFSG
NPSFTELMSRVRKTTQEAFANQDMPFERVVENLGIARDLSYSPVFQVMFVLQNSTINEEF
NLAGVNVEELHTAPGTAKFDITLELSEQSGVLYGDLEYSTDLFDESTMVRFVEHLKILFD
RVIADPALPVGQISILSDAEKKLIDTEYNNTELTLPLNDTLHGLFERQVQRTPDAEALVF
GRERLTYQQVNERANRIANFLRSEGVGVGSFVGVCMPRSNELVISMLAILKAGAAYVPLD
PNYPAERVAYMVEDTGAPIVLTHSSLLASLPDSHGNGAIRKLAVDTLSSTFERFEVSTPD
VEVAATQLGYIIYTSGSTGLPKGVMISHANATAMVHWAHTVYSPQDLHGVLFSTSICFDL
SVYEIFVTLSVGGKLIVAENILELPGLAAVAEVHLVNTVPSAIATLLRANQIPDGVRIIN
LAGEALPASLVDSLYSSTRVDRVYDLYGPSEDTTYSTYTLRLPQKPATIGRPISNTKAYL
LNPYGQWVPPGIAGELYLAGTGVTQGYLNKPEMTAEKFLSNPFSHDALYARMYRTGDLVR
HMGNGNLEYLGRIDHQVKVRGFRIELGEIQSVIGKVSGVREALVMTREERAGDKMLVAYV
ATHRERDALVPDIRLRIRERLPEYMMPSAFVLLDAFPLTPNGKVDRAALPAPALDELYAG
EYIAPRNDTEARMARIWASLLGLEKVGVKSNFFELGGHSLLATQCVARIRDEFGIEVPVK
ALFTSPTIEDLCHALEAGERVNELTPPPVQRIARDGDLPLSFAQQRLWFLNQLETGSSDF
NISTSYNMPAALRIGGTMDVKLLRKAFQFLIERHESLRTSFLIDDGSATQVIREPHEWFM
DVRDISALDHDEREAEIIRLAQDEATRSFDLIMGPIHKARRIRLLRTRLLRTAADEHVLL
LTMHHIISDGWSLNVLIRDVGEIYDSLVQGRASQLPPLEIQYADYAKWQREWMAGPVEAH
QIAYWKQHLAGVPVLELPTDRQRPAVMTFNGDYEPVKFSAALTQRLNQLAHAQGATLFMT
LLAGFYTLLYRYSGQEDICIGTPVANRVRPEFEQLIGCFVNSLALRAQLDGEMSFVDLMM
QVQELTLNGYAHQDLPFERLVDALGVARNRSHSPLFQVMFTLQNASNVQKLSLPGLDLEL
LPSVVKTAKFDLTLNLTETANGLEGMIEYNTDLFDRETVHRLVNHFEMLLGAAVEHPQQT
LAGLPMLTEAERACQLTLWNHQEPEFAFTDTLHQRFEAQVQRTPERVAIRFEDQSVTYRE
LNARANRLAHLLRARGVKANALVGVSMDRCPDMLVAILGVLKAGGAYVPVDPFNPEDRIR
FILEDAAVQLLVTQQAVEERIPAGRYERLVLEALANDLAAQPDHDPASISGPDDRAYVIY
TSGTTGKPKGVLIPHSNVIRLFTATDPWFGFNERDVWTLFHSFAFDFTVWEIWGALHFGG
KLVVVPQQLAKSPDEFYELLCTEGVTVLNQTPSAFTQLIRVDERLYNADPAAIKRLKLRY
VVFGGEALDFPALQSWIGRHGLDQPQLINMYGITETTVHVTYHRITPEDMEQRASLIGRP
IPDLDVYVLDTHRQLVPVGVPGEMYVGGQGLSHGYLNRPELTDDRFVENPFGTRLARKGH
LYERLYRTGDLARFLPDGTLEYLGRADDQVKIRGYRIELGEIVATINQYPGVSESVVLVR
EDVPGDKRLIAWLVAGETLDTQVLRAALRKQLPEYMVPSAYVLLAAMPLNHNGKINKGAL
PAPEGVAVSDREFVAPRNETEEILVEIWKDVLKLETLSVKDNFFDIGGHSLLATQVISRV
RERFEIDIALSSLFEEPTIENLALQLLQAELENSDDSDMADLLAEIEGMSDEDLKNL
NT seq 8634 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgccttgtgatgaatgcagtagatctctctcaaatgaatacgctggttggattg
ctagaggctcgcgccgctgcgcatccagataagctcgcctacacctttttaccggatggc
gaagaagccggtgttgacattacctacggtgagttggcgacacgtgcgcgtgccgtggcg
gcaaccctgctaaccaagggtgcggccggagatcgggcgttaatgctgtttccatccagc
cttgagttcgtcgtgggctttttcggatgcctgtacgcaggaatcgcggcggtgcctgcc
tatccgccacgtcgaaatcaaaaccttggccgtctgcaatccattattgacgactgcgaa
ccgtcaatcgtgatgaccaccagcaaggtaatgaccgttgccgcaccgatatttgaagaa
acccctgggctttctcatttgcagtgggcttgcgtggatgaaatttcgaacgaggcggcg
gcgacgtggagcgcaccggcaatttcggccgcaacgattgcgtttttgcagtacacctca
ggttccaccggcaatcctaaaggcgtaatggtcagccatggcaacttactggcgaacgag
gcgatgatcactacggcgttcgaaagccaagagaacgatctggttgtgagctggttgccg
ctgttccacgacatggggttgattggcactaccttgcagccgttatacattggatcgaga
gcggtatttatgtcgcctgcttcgttcctgcagaaaccggttcgctggttgcaggcggtg
tccgactataaaggcaccggaatttgcgcgccaaactttgcctacgagctctgtgcgcgg
caaatcacgcccgagcagcgggccacgttagacctttctacacttcgcgttgcgctttct
ggcgcagaagtggtgcgcccagaaaccattgatttgttctgcgatacctttgcagaatgc
ggcttcaaacgcagctctttcttgcctacttttggccttgcagaagcaacgttatttgtt
gctggcgcctgcaaagagacgcgccccctgttcaagcgcgtactggcagatgatttgtcg
caaaatcgcgtagtgctcgcgaatgcagatgcgggcgaaaaaacgctgaccctcgtatcc
aacgggaaatcaaccctcgatggccgcgttgcaatcgtagaccccaatacttttgcggtt
ttgcccgcaggagaagtgggtgagatctgggccgctgggccccacattgcacagggctat
tggaagcgcgaggaggccactaaagaaacctttgctggttataccgccgatggtgatggc
cccttcatgcgtaccggcgatttgggctgcatgttagatggtgagctttatatcacaggg
cgccaaaaagaagtcatcattattcgcggccgtaatcactatccgcaagacattgagtac
accgtccagcagagccacgtggcgctgcgcggcgacgcaggcgcggcgtttaccgttgaa
atcaacggcgaggagcgcctcgttgtggtgcaagaagttgagcgtaagtaccgcctgact
ctgaataccgaagtggtggcggcagcggttcgccaagcagtggcggaaacgcatgaatta
caggttcataccgtcgtctttatccgccctggcagcatattgaaaacctcgtcgggcaaa
atccagcgtggcgcaaatcgcaaagcgtttctagaaaacgcgctcgaagtaatttcggta
agcgcaccgcaggagcagagcgaatccagcaaaaacgccattgaagacgcgctcaagctg
gagaaacagcagtggttgcaattgcccgcagaggaacaagagccacggctggtgttgtat
ctaaaggcgatgattgcacgcgagatcagcgagtcgctggaaaaaatcaaagacgaccgc
agcctgatggcgctcggcatcgactctttgcagatcactcaacttttcacgcggctgcgc
gataaattcgaaatcgacctagagcttcctgcgctatttgaagcagaagattttgtggcg
ctcgcacgcaccatcgccaacgccttgcgcggtgagcgaagggcgcaattgccaccgcta
gagcgcgtggatcgtgagacgtggatgccgctgtcgttttctcaaaaacgcatgtggttt
ttggacaagctgcgtgagaacaacattgcctacaacctgccttttgcgctaaaaactcaa
ggtgcacttgatattcaggcggccgaaaaagcctttgaatccatggtcacccgtcacgag
gtgctgcgtacccgctacattcagaaggacggctatgcgtggcaggtaatcgaaccacct
tccgcgtggaaatttgaaacgatcgacctttcctacctgaaagaacctgccttgggtaag
gcgattcaagatcacgtttaccgtgaggcgcgcaagccttttaatcttgaaaaaggtcca
gtaattcgcacgcaattattgcgcctaccggatctggtattggaaggccacgaaaattcg
cgcgccggtgagcaaaatctgctgcttattaccatgcaccacattgcagccgacgggttt
tcgctaaaagtcattaccgacgagatttcgcgcgcatacgaggccgaactcaacgacacg
ccacttgcgcttcctgatttgccgatccagtacgcggattttgcacattggcagaagcat
ttgtttgaaagtggtttgctcgacaagcaattgcactactggacggaaaaactcagcggc
gttcctgtgcttgattttcctaccgatcgccctcggccgccggagcaaagctttgcaggt
gcaaaccactatttcaccattgataaggaccgcactgcgaagttgcggcagctaagtcgt
tcacagggtgtaaccttgtacatgactctgctttcaggctttaagacattgctgcacttg
tacaccaacagtgctgacatttgcgtgggtacaccgattgccaaccgtactacgccagaa
ctggaaaagctgattggctttttcgtcaacacccttggcctgcgaaccgatttttccggc
aatccaagcttcaccgagctgatgtctcgcgttagaaagactacgcaagaagccttcgcc
aatcaggatatgccttttgaacgcgtcgtcgagaatcttggaatcgcgcgcgatttgagc
tattcgccggtatttcaggtgatgttcgtgttgcaaaactccacgattaacgaggagttc
aaccttgctggcgtgaatgttgaagagttgcacaccgcgcccggcactgccaaatttgat
attacgctggaactcagcgaacaatccggcgttctttacggcgatctggagtattccacc
gatctgttcgatgaatccaccatggtgcgctttgttgaacacctcaagattctgtttgat
cgtgtgattgcggatcctgcattgccggtcggtcaaatcagcattctttcggatgccgag
aaaaagctgatcgacaccgaatacaataacaccgagcttacgctcccgctgaacgacact
ttgcacggcctgtttgaacgccaggttcaacgcactcccgatgccgaagcattggtgttt
ggccgcgaacgtctgacctatcaacaggtgaacgagcgagcaaaccgcattgccaacttc
ttgcgcagtgaaggcgtaggagttggaagctttgttggcgtttgcatgccgcgctctaac
gaacttgtgatcagcatgctggcgattctcaaggcgggtgcggcttatgtgccccttgat
ccgaactatccggcagagcgcgttgcttacatggtcgaagataccggcgcgccgatcgtg
ctgacgcactcgtccttgcttgcaagccttccagattcccatggaaacggcgcgattcgc
aagcttgccgtcgatacgctcagcagcacatttgagcgctttgaagtcagcacgcctgac
gttgaagtggccgcaacccagcttggctatattatttatacctccggctctactgggctt
ccaaagggcgtaatgatcagccatgccaacgcaactgcgatggtgcattgggcacatacg
gtttattcgccacaagatttacacggcgtacttttctccacttcgatttgtttcgacctt
tccgtctacgaaatttttgtaacgctatcggtaggcggcaagctaatcgttgccgaaaac
attctggaattgccggggctggctgcggttgccgaggtgcatttggtcaatacagtgccc
tctgcaattgcgactctgttgcgtgccaatcaaattccagacggtgtacgcattatcaac
cttgcaggggaggcgttgcctgcgagcttggtagattcgctctattcgtccacccgtgtc
gatcgtgtgtacgatttgtacggcccctcggaagacaccacttattcgacctatacgctg
cgcctgccgcaaaagccagcgaccatcggccggccaatttccaataccaaagcgtatttg
ctcaatccgtatggccagtgggtgccacctggaattgctggtgaactgtatttggcgggc
actggcgttacgcaagggtatttgaacaagccagagatgacggcggaaaaatttctgtcc
aacccatttagtcacgatgcgctgtatgcgcggatgtatcgcacgggcgaccttgttcgt
catatgggcaacggcaatcttgaataccttggcaggatcgaccaccaagtgaaggtgcgt
ggttttcgcatcgaactcggagaaattcagtctgtgattggcaaggtgtctggcgtacgt
gaagccctcgtgatgacgcgcgaagagcgtgcgggcgataaaatgttggttgcctatgtc
gccactcatcgtgaacgtgatgcgcttgtgcccgatattcgcctgcggattcgcgagcgc
ctaccggaatacatgatgccttctgcgtttgtgctgctcgacgcgttcccgcttacccca
aacggtaaggtagatcgcgccgcacttccagcacctgcgttggatgagctgtatgcaggc
gaatacatcgcgccgcgtaacgacaccgaagcgcgcatggcgcggatttgggccagtttg
ctcggtttagaaaaagttggcgtcaagagtaacttctttgagttgggcgggcactcgttg
ctggcaacgcagtgcgttgcgcggattcgtgatgaattcggaatcgaagtgccggtaaaa
gcgctcttcacctcgcctacaattgaagatttgtgtcacgcgctggaagcgggtgagcgt
gtgaacgagctgactccgccgccggttcagcggattgcgcgtgacggcgatctgccgcta
tccttcgcgcagcagcgcttgtggttcttgaatcaattggaaaccggcagttccgatttc
aatatcagcacgtcctataacatgccggctgcgctgcgcattggtggcacgatggatgtg
aagctgctgcggaaagcattccagtttttgattgaacgccacgagtcgctgcgtacttcc
ttcctgattgatgatggcagcgccactcaggtcattcgtgagccgcatgaatggtttatg
gatgtgcgcgatatttccgctctggatcatgatgagcgtgaagccgagattattcgcttg
gcgcaggatgaagcgacgcgctccttcgacttgatcatggggccgattcacaaagcgcgc
aggattcgcttgctgcgcacgcgcttgctgcgcacggccgccgacgagcacgttttgctg
ttgacgatgcaccacatcatttccgatggctggtcattgaacgtactgatacgcgatgtg
ggtgagatctacgattctctggttcaagggcgcgcatcgcaactaccgccattagagata
caatatgccgactacgcgaagtggcagcgggagtggatggccggcccagtggaagcgcac
caaatcgcctactggaagcagcaccttgccggtgttcccgtattagaattaccgactgat
cgccaacgccccgcagtgatgacgtttaacggcgattatgagccggtgaagttttctgcg
gcgcttactcagcgcttgaaccaactggcacatgcgcagggcgcgaccctgttcatgacg
ctgctcgcaggtttctacaccttgctctaccgctattctggccaagaagatatctgcatt
ggaacgccggtagccaaccgcgtgcggccggagtttgagcagttgattggctgtttcgtt
aacagcttggcgctgcgcgctcagttggatggcgaaatgagctttgtcgatctaatgatg
caggtgcaagaactcacgctgaacggttacgcacatcaggatctacctttcgaaaggttg
gtcgatgcgctgggcgttgcgcgcaatcgcagccactcaccgctgttccaagtgatgttt
actttacagaacgcatccaacgttcagaagctctcgcttcccggccttgatctggaattg
ctgccttctgtagtaaaaacggcgaagttcgatctaacgcttaacctgaccgaaaccgca
aacggtctagagggcatgatcgaatacaataccgatctctttgatcgtgagaccgtgcat
cgcttggtgaaccattttgaaatgctgctgggcgctgccgtagaacatccacagcagacc
ttggctggcttgcccatgctcaccgaagcggagcgcgcctgtcagttgacgttatggaat
catcaggagcctgaattcgcctttaccgatacactgcaccaacgtttcgaagcacaggta
caaagaacacccgagcgcgtagcgatccggtttgaagatcagagcgttacttatcgcgaa
ctcaacgcacgcgccaaccgcttggctcacctattgcgcgcacgaggcgtgaaagcaaac
gctttggtcggtgtgtcgatggatcgctgcccagatatgctggtcgcgattctcggcgta
ttgaaagccggtggcgcgtatgtgccggtcgatcctttcaacccggaagatcgtatccgc
tttattctggaagacgctgccgtacaactgcttgtgacgcagcaagcggtagaggaacgc
atccccgctgggcgttatgaacgcctcgtactggaagcgttagcgaacgatcttgctgcg
caaccggatcatgatcctgcgagtatttccgggccagatgatcgcgcttatgtgatttat
acgtccggtactaccggcaaaccgaagggtgtattgatcccccatagcaacgtgatccgt
ttgtttacggcgaccgatccttggtttgggtttaacgagcgcgatgtgtggacgctgttc
cattcctttgcgtttgactttacggtttgggaaatctggggcgcgttgcactttggcggt
aaattagtggttgtgccgcaacagttggcaaaatcacctgatgagttttatgagttgctc
tgcactgaaggcgttacagtgctaaaccaaacgccatcggcatttacgcagttgattcgt
gtggatgaacgtctttacaatgccgaccctgccgccatcaagcgcctgaagctgcgctac
gtggtattcggtggtgaggcgttggacttcccagcgctacagtcgtggattggccgtcac
gggctggatcagccgcagctgatcaatatgtacgggattaccgagacaaccgttcacgtg
acctaccacaggattacgccagaagacatggaacagcgcgcaagccttatcggccgcccg
attccagatcttgatgtgtatgtgctagacacgcatcgccagcttgtgccagtgggtgtg
cccggtgagatgtacgtgggcggccagggcctgtcgcatggttatttgaatcgaccagag
cttaccgacgatcgctttgttgagaatccttttggaacgcgccttgcgcgcaaagggcat
ttgtacgagcgtttgtaccgtaccggcgatcttgcgcgctttttgccagatggcacgctc
gaatacctcgggcgcgcggatgatcaagtgaagattcgcggctatcgtattgagttgggc
gaaatcgttgcaacgatcaaccaatatccaggcgtttccgagtccgtagtgttggtgcgc
gaggacgttccgggcgataagcgcttgattgcgtggctggttgccggtgaaacgctggat
actcaggtgcttcgtgccgctctgcgcaagcagttgccggaatatatggtgccatcggcg
tatgtgttgcttgctgcaatgccactgaaccacaacggtaagatcaacaaaggtgcttta
cccgctcctgaaggggttgccgtaagcgatcgtgagttcgtagcgccgcgtaatgaaacc
gaagaaatactggtggaaatctggaaagacgtactgaagcttgaaactttgagcgtcaag
gataacttctttgacattggcggccactcgctcttagcaacccaagtgatttcgcgcgtt
cgcgaacgctttgagatcgacattgcgctaagctcactcttcgaagaacccaccattgag
aaccttgccttgcagcttttgcaggcagaactggaaaacagtgatgatagcgatatggct
gatttattggctgaaatagaaggcatgtcggatgaggatctgaaaaacctctaa

DBGET integrated database retrieval system