KEGG   Gamma proteobacterium HdN1: HDN1F_34290Help
Entry
HDN1F_34290       CDS       T01300                                 

Definition
(GenBank) Malate dehydrogenase
  KO
K00024  
malate dehydrogenase [EC:1.1.1.37]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
Citrate cycle (TCA cycle)
Cysteine and methionine metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:gpb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HDN1F_34290
   00620 Pyruvate metabolism
    HDN1F_34290
   00630 Glyoxylate and dicarboxylate metabolism
    HDN1F_34290
  Energy metabolism
   00680 Methane metabolism
    HDN1F_34290
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    HDN1F_34290
Enzymes [BR:gpb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     HDN1F_34290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4164674..4165654)
Genome map
AA seq 326 aa AA seqDB search
MKKPVRVTVTGAAGQISYSLLFRIASGEMLGKDQPVILQMLEITPALKALNGVAMELDDC
AFPLLHGMVQTDNPSVAFKDTDYALLVGARPRGPGMERKDLLEANAAIFSVQGKAINDNA
SRDIKVLVVGNPANTNALIAQRNAKDINPRQFTAMMRLDHNRSLTQLAQQTGSSINDIRK
MVVWGNHSSTQYPDISKATVSGKAAEGLVEQAWYRETFIPTIQQRGAAIIQARGASSAAS
AANAAINHMRDWALGTPEGDWVSMGVYSDGSYGISEGLIYSFPCVCKDGNWDIVQGLEVS
DFSREKMKATEKELSEERDAVKHLLP
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacctgttcgagttaccgttactggcgcagcgggccagatcagctactcactt
ctgttccgcattgcatccggcgaaatgctgggcaaagatcagcccgtaatcctgcaaatg
ctggaaatcacgcctgctctcaaagcgctgaacggcgtggccatggaacttgatgattgc
gcattcccactgctgcacggtatggtgcaaacggacaacccaagcgtcgcgttcaaagat
accgactacgcactcctcgtaggtgcgcgtccacgcggccctggcatggagcgtaaagat
ctgctcgaagccaacgcagcgattttctcggtacaaggcaaggccatcaacgacaacgcc
agccgcgatattaaagtgctcgtggtaggcaaccctgccaacaccaacgcgctgatcgct
caacgtaacgcaaaagacatcaatccgcgccagttcaccgcgatgatgcgccttgatcat
aaccgttcgctgacccaactggcccagcaaaccggcagctccatcaacgacattcgcaaa
atggtcgtttggggcaaccactcctctacccaataccctgacatttccaaagccaccgtt
tccggcaaggcagccgagggtttggttgaacaggcttggtaccgtgaaaccttcattccc
accattcaacagcgcggtgcagcgatcattcaggcgcgtggcgcaagctctgctgcttct
gctgccaatgcggccatcaaccacatgcgcgattgggcgctgggcacgcccgagggcgat
tgggtgagcatgggcgtatacagcgacggctcatacggtatcagcgaaggcctgatctac
tccttcccctgcgtctgcaaagacggcaactgggacatcgtacaaggtcttgaagttagc
gatttcagccgcgaaaaaatgaaggcgactgagaaagagctgtctgaagagcgcgatgca
gtaaaacacctgctgccttga

DBGET integrated database retrieval system