KEGG   Gemmatimonas phototrophica: GEMMAAP_16565Help
Entry
GEMMAAP_16565     CDS       T04580                                 

Definition
(GenBank) hypothetical protein
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
gph  Gemmatimonas phototrophica
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:gph00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    GEMMAAP_16565
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    GEMMAAP_16565
Enzymes [BR:gph01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     GEMMAAP_16565
Bacterial toxins [BR:gph02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   GEMMAAP_16565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3944906..3946057)
Genome map
AA seq 383 aa AA seqDB search
MSGLRRRWFRLLSHLLLVSPAVFAAACRHGSAHRENSALFVPHVVDLDVRGVGAPVYRIP
ALAVTRRGTLLAAYDARPTMADVPSNIALVLRRSTDGGRSWGPRETVRRDTVPYGYGDPS
FVVDHHTGRVFLFHVASIRQGFFGSSTGNRDDDPNILHVDVSASDDEGQTWQHRRLTSQV
KDPTWGGLFGSSGAGVQLAVGKHRGRLLQPVVIKRAEGVYAASLISDDHGATWRMGALVG
PGMDEHELVELPDGTVRLDSRARPFRLVADSHDGGVTYSTPRPDSLRVDPANNAGLLAIG
QGARRALLFSNTGDRAERQRLTVRLSCDNGRTWPFSKVMVPGPSAYSTMALLDEHTVGML
YERGSYDAISFVRFPANWLGTCR
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgagtgggctccggcgtcgctggttccgcctcctatcccacctgctgctggtgagtccc
gctgtattcgctgccgcatgtcgtcatgggtccgcacaccgcgagaactccgcgttgttc
gtcccgcacgtggtggatctcgatgtccggggcgtcggcgcgccagtctatcgaattccg
gcccttgcagtcacgcgacgcggaacgttactcgccgcctacgatgctcgccccaccatg
gccgatgtccccagcaacattgccctcgtgttacgacgcagcaccgatggcgggcgcagc
tgggggcctcgtgagaccgtgcgtcgcgacaccgttccgtacggatatggcgatccgagt
ttcgtggtcgatcaccacaccggacgcgtatttctctttcacgtagcgtccattcgccag
ggcttctttggcagcagcaccggtaatcgtgatgacgatccgaacatcctgcacgttgat
gtcagtgcctcggacgatgagggccagacgtggcagcatcgacggctcacctctcaggtg
aaagatccgacgtggggcgggctgttcggatcgtcgggagcgggggtgcagctggcggtc
ggaaagcatcgcggccggctgctgcagccggtggtgatcaagcgggcagagggcgtgtat
gccgcatcgctgatcagcgatgaccacggcgccacgtggcggatgggcgcactcgttggc
ccgggcatggacgagcatgaactcgtggaactccccgacgggaccgtgcgtctcgactcg
cgggcccgtccctttcgtctcgtggccgactcccacgatggtggcgtgacctacagtaca
ccgcggccagattccctgcgggtggatccggccaacaacgcggggctgctggccatagga
cagggcgcgcgtcgagcgctgctgttcagcaacacgggcgaccgcgccgagcgtcaacgg
ctgacggtgcggctgtcgtgcgacaacggacgcacctggccattcagcaaggtgatggtg
cccggcccctcggcgtattccaccatggcgctcctcgatgaacacaccgtggggatgctc
tacgagcgtggctcgtacgacgccatcagcttcgtgcgctttcccgccaactggctgggg
acctgtcgttga

DBGET integrated database retrieval system