KEGG   Gordonia polyisoprenivorans: GPOL_c27000Help
Entry
GPOL_c27000       CDS       T01719                                 

Gene name
pyk
Definition
pyruvate kinase Pyk (EC:2.7.1.40)
Orthology
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Overview; Carbon metabolism [PATH:gpo01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:gpo01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:gpo00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:gpo00620]
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:gpo00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
LinkDB All DBs
Position
complement(3059155..3060597)
Genome map
AA seq 480 aa AA seqDB search
MSTVTRRTKIVCTLGPATNSEERLKELVEAGMDVARLNFSHGSHEDHRTVYERVRRAGDA
AEKAVGILADLQGPKIRLGKFVDDGALNGQVMWATGEEVRITVDDVVGTHDRVSTTYKQL
AEDAEAGDRLLVDDGKVGLKVTAIDGNDVVCVVTEGGPVSNNKGLNLPGVKTSIPALSEK
DIADLEFALQLGVDLVALSFVRSPADIELVHEVMDRVGRRVPVIAKLEKPEAVDNLEAIV
LAFDGVMVARGDLGVELPLEQVPLVQKKAIQMARENAKPVIVATQMLDSMIENSRPTRAE
ASDVANAVLDGADAVMLSGETSVGKWPIETVQTMTRICVAVETGSRDVPPLSHVPRTKRG
IISYAARDIGERLEVKAMVAFTQSGDTVRRLARLHSRLPLLAFTPTQAVRSQLALSWGTE
TFIVDHVDTTDHMIDQVDHQLLRIGRLKDGDVVVIVAGAPPGTVGSTNMIHVHRIGEQDH
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaccgtgacacgtcgtaccaagatcgtctgcaccctgggtcccgccaccaactcc
gaggagcgtctcaaagagctcgtcgaggcgggcatggatgttgctcgactcaacttcagc
catggcagccatgaggaccatcgcaccgtctacgaacgtgtgcgtcgcgcgggcgatgcc
gcggagaaggccgtgggcattctcgccgacctacaaggacccaagatccgactcggcaaa
ttcgtcgacgacggcgcactcaacggccaggtcatgtgggccaccggagaagaggtccgc
atcaccgtcgacgacgtcgtcggcacccacgaccgcgtctcgaccacctacaaacaactc
gccgaagacgccgaagccggagaccgcctcctcgtcgacgacggcaaggtcggactgaag
gtcaccgcgatcgacggcaacgacgtcgtctgcgtggtcaccgaaggcggcccggtcagc
aacaacaaaggcctgaacctgccgggcgtcaagacctcgatccccgccctgagcgaaaag
gacatcgccgacctcgagttcgcactgcaactcggcgtcgacctcgtcgcactctccttc
gtgcgcagcccggccgacatcgaactcgtccacgaagtgatggaccgcgtcggacgccgc
gtcccggtgatcgccaaactggaaaagcccgaagccgtcgacaacctcgaagccatcgtg
ctggccttcgacggtgtcatggtcgcccgcggtgacctgggcgtggaactgccgctcgag
caggttcccctcgtgcagaagaaagccatccagatggctcgcgagaacgccaaaccggtg
atcgtggccacccagatgctggactcgatgatcgagaactcccggcccacccgcgccgag
gcctccgacgtcgccaacgccgtcctcgacggtgccgacgccgtgatgctctccggcgag
acctccgtcggcaaatggccgatcgagaccgtgcagacgatgacccgcatctgcgtggca
gtcgaaaccggctcacgtgacgtgcccccgctctcccacgtcccccgcacaaaacgcggc
atcatctcctacgccgcacgcgacatcggagaacgcctcgaggtcaaggccatggtggcg
ttcacccagtccggcgacaccgtccgccgactggcgcggctgcactcccgcctgccgctg
ctcgcgttcacacccacccaggccgtacgcagccaactcgccctgagctggggaaccgag
accttcatcgtcgatcacgtcgacaccaccgaccacatgatcgaccaggtcgaccaccag
ctgctgcgcatcggtcggctcaaggacggcgacgtcgtcgtcatcgtcgccggcgcgccg
cccggcaccgtcggatcgaccaacatgatccacgtccaccggatcggcgaacaggaccac
tga

DBGET integrated database retrieval system