KEGG   Gordonia polyisoprenivorans: GPOL_c44010Help
Entry
GPOL_c44010       CDS       T01719                                 

Definition
(GenBank) putative 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
gpo00250  Alanine, aspartate and glutamate metabolism
gpo00410  beta-Alanine metabolism
gpo00640  Propanoate metabolism
gpo00650  Butanoate metabolism
gpo01100  Metabolic pathways
gpo01120  Microbial metabolism in diverse environments
Module
gpo_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    GPOL_c44010
   00650 Butanoate metabolism
    GPOL_c44010
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    GPOL_c44010
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GPOL_c44010
Enzymes [BR:gpo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     GPOL_c44010
Amino acid related enzymes [BR:gpo01007]
 Aminotransferase (transaminase)
  Class III
   GPOL_c44010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AFA75404
UniProt: H6MWJ3
LinkDB All DBs
Position
4992390..4993682
Genome map
AA seq 430 aa AA seqDB search
MTAVEHLPQTATLSPILKQATPVIVDHAQGSWVYGTDGQSYLDFTTGIGVTSTGHCHPRV
VAAAQEQCAKVIHAQYTTVMHPPLLELTAKLGGVLPLGLDSVFYANSGSEAVEAAIRLAR
MATARPNIVVFQGGFHGRTVAAASLTTAGTRFSAGFSPLMGGVHMAPFPYAYRYGWDTET
AVDFALTELDYLLTSRVAPDDTAAFLIEPVLGDGGYLPTPPRFLAGLRERADRHGILLIL
DEVQAGFGRTGRFWGHQHAPISPDILITAKGLASGFPISAIAAPTELMTKAWPGSQGGTY
GGNAVAAAAAIATLDVIAEENLVDNAAIRGEQLLTGIREVTTGLDAVGDVRGLGLMIGIE
FVTRVGDRCMPDAATALAVQRATTAHGLLTLTCGPAGNVVRLIPALVVTADEIALGIERF
GAAVHSVLGA
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccgtcgaacacctcccccagaccgcgaccctgtcccccatcctcaaacaggcc
acgccggtgatcgtcgatcacgcgcagggctcgtgggtgtacgggaccgacggccagtcc
tacctcgacttcaccaccggcatcggggtcaccagcaccggccactgccacccgcgggtg
gtcgccgccgctcaggagcagtgcgccaaggtcattcatgcccagtacacgacggtcatg
catccgccgttgctcgagctgacggcgaaactcggcggggtcctcccgctcggcctcgac
tcggtgttctacgcgaactccggatcggaggccgtcgaggccgcgatccgcctggcccgg
atggccaccgcgcgacccaatatcgttgtcttccaaggaggttttcacgggcgcaccgtc
gccgcagccagcctcaccaccgcgggcacccggttctcggcgggcttctccccactgatg
ggcggggtgcacatggccccgttcccctacgcctaccgctacggctgggacaccgagacc
gccgtcgacttcgccctcaccgaactcgactacctgctcacctcacgcgtggcacccgac
gacaccgccgccttcctcatcgaacccgtcctcggcgacggcggctatcttcccactccc
ccaaggtttctcgccggattacgcgagcgcgccgatcgccacggaatcctactgatcctc
gacgaggtccaggccggcttcggtcgcaccggacggttctggggccaccagcatgccccg
atcagccccgacattctgatcaccgccaagggactcgcctccggtttcccgatctcggcg
atcgccgcacccaccgagctgatgaccaaggcctggccgggctcgcagggcggcacctac
ggtggcaacgctgtggccgcggcagccgcgatcgccaccctcgacgtgatcgccgaggaa
aacctcgtcgacaacgccgccatccgcggggaacaactcctcaccggtatccgcgaggtg
accaccgggctcgacgccgtcggcgacgttcgcggactcgggctgatgatcggcatcgaa
ttcgtcacccgcgtcggtgaccgctgcatgcccgacgccgctaccgcacttgcggttcag
cgcgccacgacggcccacgggttgctgaccctgacctgcggcccggccggcaacgtcgtg
cgcctgatccctgcactcgtcgtcaccgccgacgagatcgcgctcggcatcgaacgcttc
ggcgctgcggtgcactcggttctcggcgcatga

DBGET integrated database retrieval system