KEGG   Paraglaciecola psychrophila: C427_0921Help
Entry
C427_0921         CDS       T02535                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
gps  Paraglaciecola psychrophila
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gps00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    C427_0921
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C427_0921
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    C427_0921
Enzymes [BR:gps01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     C427_0921
Peptidoglycan biosynthesis and degradation proteins [BR:gps01011]
 Precursor biosynthesis
  Amino acid ligase
   C427_0921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
853731..854693
Genome map
AA seq 320 aa AA seqDB search
MSKQQLIYPNMNPKDYGKVAVMLGGSSAEREVSLNSGKAVLCGLLEMGVDAHVFDPAEQP
LTQLLAEKFERVVIMLHGRGGEDGSLQGALQQLNLPYSGSGVLGSALCMDKIRSKQVWQS
LGLPTAIYKIADKRSFDAGSCKAIMAELGNEVMVKPAQEGSSIGMAKVNSALQLEIAIQD
AFKYDDKVLIEQFVHGSEYTVSILNGKALPSISMSTPRVFYDYAAKYQADSTVYSCPSGL
PDALEIMLGELALDAFDALAGSGWGRVDFMQDKLGRFYLLEANTVPGMTEKSLLPMAAKE
AGLSFAELSLSVLATADVVR
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaagcagcaactaatttacccaaacatgaatcctaaagactatggaaaagtcgcg
gtcatgttgggcggctcatctgctgaaagagaggtatcactgaattcgggtaaagccgtg
ctatgcgggttgttagaaatgggagttgacgctcacgttttcgaccctgcagagcagcct
ttaacccagctattggctgaaaagtttgagcgtgtggtgatcatgttacatggccgtggt
ggtgaagatggttcactccaaggggcattgcagcagcttaatttaccttattctggaagt
ggtgttttaggctctgcgttgtgtatggataaaattcgcagcaagcaggtgtggcaaagt
ttgggacttcctacagctatttataaaatagctgataaaagaagctttgatgcgggatca
tgcaaggctataatggctgaactgggaaatgaggtaatggtcaaacctgcgcaggaaggg
tctagcataggtatggcgaaagtgaatagtgcgctacaactagaaatagccattcaagac
gcgtttaaatacgatgataaggtcttgatagaacaattcgttcatggttctgaatatacc
gttagcatactgaatggcaaagctctgccatcgattagtatgtccactccccgtgttttt
tatgattatgcagcgaaatatcaagcggatagcactgtgtatagttgccccagtggtttg
cccgatgcgttagaaatcatgttgggtgagttagcactagatgcatttgatgcattggct
ggatcaggttgggggcgggtggattttatgcaagataaacttggtcgtttttatttgtta
gaagcgaacacggtgccaggcatgactgaaaaaagtttattgccaatggcagctaaagag
gctggtttaagttttgctgaattgtctttgtctgttctggcaacagcggatgtggtgaga
tga

DBGET integrated database retrieval system