KEGG   Paraglaciecola psychrophila: C427_1571Help
Entry
C427_1571         CDS       T02535                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
gps  Paraglaciecola psychrophila
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gps00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    C427_1571
Enzymes [BR:gps01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     C427_1571
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1478173..1480167
Genome map
AA seq 664 aa AA seqDB search
MMKINKTLLAAVLGSTLLGQPIVQAEPTTFVHLFEWSWLDVATECETFLGPKGFAAVQVS
PPNEHITTSQWWARYQPVSYMLESRGGSRAEFIDMVQRCDAVGVDIYVDAIINHMAAGSG
TGTAGNSFGNKSYSIYSPQDFHTSCSIDNYSNRYQVQNCELVGLADLDTDATYVQDTIAA
FLSDLTNIGVKGFRLDASKHMPTEDISTILSKVSGAPLIFQEVIDQGGEAISAAEYASNG
LVTEFKYSVEIGNTFSNGNLAWLSNFGEGWGFMPSYQAVVFVDNHDNQRGHGGGGNVITY
EDGRLYDLANVFMLAYPYGYPKLMSSYDYKGDTDVGGPSVPVHNNGTLECFADKWKCEHR
YSYMSGGVDFRNNTTNHFAISDWWDNGANQIAFGRGSQGFVAINKETFGLNSNVATSMAQ
GQYCNVLKGELSSDKLSCSGGVITVQPDGSINLDVPAFDAVAIHHNAKIQGTSTPDDIQR
TVLFIQAQTQGGQNMFVRGGIDHNYAASNLGLNCTSNNYVCAMPISHNNLNNTTTSSWKM
NDNFLDWYGIEAGQSTEAEGTALDWTTDIWPAAYGPLKTVENDGYGQEPLNIWGPHHWML
DVEMDCSKTVNGWFELKAYIKNGQGWEGDIQQSNTPYSSNNHFAQCGKINKFDFNNSNVE
IKDF
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaataaataaaacacttctggctgctgttcttggcagcacattactcgggcag
cccattgttcaagctgaacccaccaccttcgttcatttgtttgagtggagctggctggac
gttgctaccgaatgcgaaacatttttaggcccaaaaggttttgcggcggttcaggtatcg
ccacctaatgaacatattactactagccaatggtgggctagatatcaaccggttagttat
atgctggaaagtcgaggcggtagccgtgctgaatttattgatatggtgcagcgatgtgat
gcggtaggtgtcgatatctatgtggatgccattattaatcatatggccgcggggtctggc
accggaactgctggtaatagtttcggtaataagagttactcgatttattcacctcaagat
tttcatactagttgttctatagacaattatagtaaccgttatcaagtacaaaactgcgaa
ttagtagggctagcagatttagatactgatgcgacctatgttcaagatacgattgcggct
tttttgagtgacttaaccaatattggagtgaaaggttttcgtttagacgcatctaagcat
atgccaactgaagatatttcaacaatcctctctaaagtatccggtgcaccattgatattt
caagaagtcattgatcaaggaggtgaggctatttctgcagcagaatatgcgagtaatggt
ttagtcaccgaatttaaatacagtgttgaaattggcaatacctttagcaacggcaacctt
gcatggctaagtaattttggcgaaggatgggggtttatgccaagttaccaagccgttgtt
tttgtcgataaccatgataaccagcgtggccatggtggtggtggcaatgttatcacttat
gaagatggtcgtttatacgatttagctaacgtatttatgttggcgtacccttatggctat
ccaaaactcatgtcgagttatgattacaaaggcgatactgacgtgggtggaccttcggta
cctgttcacaataatggtacgttagaatgttttgcggataagtggaaatgtgaacaccgt
tattcgtatatgtcaggtggcgtagattttcgtaacaacacgacaaatcattttgcgatt
tccgattggtgggataatggtgctaatcagattgcgtttggtcgcgggtcacaaggtttt
gttgctataaacaaagaaacctttggtctaaattcaaacgttgctacctctatggcacaa
ggccaatattgtaacgtgttaaaaggcgagctaagtagcgataaactaagctgttcgggt
ggtgtgatcacggtgcaacctgatggttcaattaatctggatgtgcctgcttttgatgcc
gttgctattcatcacaatgctaagattcaaggtacctcgacgccagatgatattcagcgc
actgtgttatttattcaagcacaaacacaaggaggtcaaaacatgtttgtacgtggaggt
atagaccacaactatgccgcatccaatttaggtttgaactgcacgtcaaataattatgtt
tgtgcgatgccaatcagccataacaacctaaacaataccaccacctcctcttggaaaatg
aacgataactttcttgattggtatggaatagaagcggggcaaagtacagaagccgagggc
accgcactcgattggacaacggatatttggcctgcagcatacggcccactaaaaaccgta
gaaaatgatggttatggtcaagagcctcttaacatttgggggccgcaccactggatgcta
gatgtagagatggattgtagcaaaaccgtcaacggttggtttgaactcaaagcttatatt
aaaaatggtcaaggttgggaaggtgatatccaacaaagcaatactccttacagctcgaat
aatcattttgctcaatgtggcaaaatcaataaattcgactttaataacagtaatgtggaa
atcaaagatttttaa

DBGET integrated database retrieval system