KEGG   Gibbsiella quercinecans: AWC35_12545Help
Entry
AWC35_12545       CDS       T05060                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
gqu  Gibbsiella quercinecans
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gqu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    AWC35_12545 (glpD)
Enzymes [BR:gqu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AWC35_12545 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2765741..2767249
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLLLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKLAPHIAFPMRFRLPHQPHLRPAWMIRTGLFLYDHLGKRTSLPGS
KGLRFGSDSVLKPSLTRGFEYSDCWVDDARLVVLNAQEVVERGGEVRTRTRVTRAWREDG
VWVVEATDVDSGKTLSWRAKGLVNATGPWVKHFFDDGLQLKSPYGIRLIKGSHIVVPKAH
NQPQAYILQNEDHRIVFVIPWLDEFSIIGTTDVEYHGDPKDVKIDDSEIDYLLKVYNDHF
KKQLGRNDIVWTYSGVRPLCDDESDSPQAITRDYTLDVHDDQGKAPLLSVFGGKLTTYRK
LAEHALEKLARYYPKAGPAWTKNGALPGSDIGGDRDSYAAKLRRKHGWLPEALARRYART
YGSHSEQILAGANGLADLGEAFGHGLYEAELRYLVAKEWVVELDDAIWRRTKLGMWLDEA
QQARVKEWLAQHSKPKTLSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagacttgatcgttatcggtggtggcattaacggtgccggcatcgcggcg
gatgctgccggccgcgggctgtccgtactgctactggaagcgcaagacttggcctgcgct
acgtcttccgccagttccaaactgattcacggtggcctgcgttatctggaacactacgaa
ttccgcctggtcagcgaggcgctggccgagcgcgaggtgctgttgaaactggcgccgcac
attgcttttcccatgcgtttccgtctgccgcaccagccgcatttgcgcccggcgtggatg
atccgcaccgggctgttcctgtacgaccatctgggcaaacgcaccagcctgccgggcagc
aagggcttgcgctttggctctgactcggtgttaaaaccttcgttaacgcgcggtttcgaa
tattccgactgctgggttgatgatgcgcgcctggtggtgttgaacgcgcaggaagtggtc
gaacgcggcggcgaagtgcgcacccgcaccagggttacccgcgcctggcgtgaagacggc
gtatgggtggtcgaagccacggacgtcgacagtggcaaaactctcagctggcgcgccaaa
ggtctggtcaacgccaccggcccgtgggtcaaacacttcttcgacgatggcctgcagttg
aaatcgccttacggtatccgcctgatcaagggcagccacatcgtggtgccgaaggcgcat
aaccagccgcaggcgtatatcctgcagaatgaagaccaccgcattgtgttcgtcatcccg
tggctggatgaattctccatcatcggcaccacggatgtggaatatcacggcgatcccaaa
gacgtgaagattgacgatagcgaaatcgactacctgctgaaggtctacaacgatcacttc
aagaagcaactgggccgtaatgatatcgtctggacttattccggcgtgcgcccgctgtgc
gatgacgaatcggattcgccgcaggccatcacccgcgattacacgctggatgtgcatgac
gatcagggcaaggcgccgttgctgtcggtgttcggcggcaagctcaccacctaccgcaag
ctggcggagcacgcgttggaaaaactggcgcgctactacccgaaagccggcccggcctgg
actaaaaacggcgccctgcccggcagcgatatcggcggcgatcgtgacagctatgccgcc
aaactgcgccgcaagcacggctggctgccggaggcgctggcccgccgctatgcgcgcacc
tacggtagccacagcgaacagatcctggccggcgccaacggcctggccgatctgggtgaa
gcgtttggccacgggctgtatgaggcggagctgcgctatctggtggcgaaagagtgggtg
gtggaactcgacgatgctatctggcgccgcaccaaactgggcatgtggctggacgaagcg
cagcaggcgcgcgttaaagaatggctggcccagcacagtaaaccgaaaacgctgtcgttg
gcctcgtaa

DBGET integrated database retrieval system