KEGG   Gibbsiella quercinecans: AWC35_15035Help
Entry
AWC35_15035       CDS       T05060                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
gqu  Gibbsiella quercinecans
Pathway
gqu00250  Alanine, aspartate and glutamate metabolism
gqu00410  beta-Alanine metabolism
gqu00640  Propanoate metabolism
gqu00650  Butanoate metabolism
gqu01100  Metabolic pathways
gqu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gqu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AWC35_15035
   00650 Butanoate metabolism
    AWC35_15035
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AWC35_15035
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AWC35_15035
Enzymes [BR:gqu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AWC35_15035
Amino acid related enzymes [BR:gqu01007]
 Aminotransferase (transaminase)
  Class III
   AWC35_15035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ATA20552
UniProt: A0A250B3L9
LinkDB All DBs
Position
3307223..3308488
Genome map
AA seq 421 aa AA seqDB search
MKNAELDQRRQDATPRGVGVMCGFYAERAENATLWDVEGREVIDFAAGIAVLNTGHRHPK
VIAAVEKQLRAFTHTAYQIVPYESYVALAERINQVAPIAGPCKTTFFTTGAEAVENAVKI
ARSYTGRPGIITFGGGFHGRTYMTMALTGKVAPYKLGFGPFPGSVFHAQYPNALYGVSTE
DAMHSLERIFKADIDPKQVAAIVLEPVQGEGGFNVAPAEFMQALRELCDTHGILLVTDEV
QSGFARTGKLFAMDYYSVKPDLITMAKSLAGGIPLSALAGRAEVMDAPGPGGLGGTYAGN
PLAVAAAHAVLDVIEEEQLCQRAQRLGQHLVEFLQQARSTCPAIVDIRALGSMVAVEFND
PQTGKPSAAYTHKVQQKALEEGLLLLTCGVNGNVIRFLYPLTIPDDQFNKALGILGRALT
N
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgcagagttggatcaacgtcgtcaggatgctaccccgcgcggggtgggggtt
atgtgcggtttttacgccgagcgtgcggaaaacgccaccctgtgggatgtggaagggcga
gaggtgattgactttgccgccgggattgcggtgctcaataccggccaccgccacccaaaa
gttatcgctgccgttgaaaaacaactgcgggcatttacccataccgcttaccagatcgtc
ccttatgaaagctatgtggcgctggccgagcgtatcaaccaagtggcgccgattgcaggg
ccgtgtaaaaccacctttttcaccaccggtgcagaagccgttgaaaacgcggttaaaatc
gcccgttcttataccggccgccctggcatcatcacctttggcggcggcttccatggccgt
acctacatgaccatggcgctgaccggcaaagtggcgccgtacaagctgggcttcggtccg
ttccctggttccgtcttccacgcccagtacccgaacgcgctgtatggcgtcagcactgaa
gatgcgatgcatagcctggagcgtatctttaaagcggatatcgatcctaaacaggtggcg
gccattgtgctggaaccggttcagggtgagggcggctttaacgttgccccggctgaattt
atgcaggcgctgcgcgaactgtgcgacacgcatggcatcctgctggtgacggatgaagtg
cagagcggctttgcccgtaccggcaagctgtttgccatggattattacagcgttaagccg
gatctgatcactatggcgaaaagcctggcgggcggtattccgctctctgcgcttgccggc
cgcgccgaagtgatggatgcgccggggcctggcgggctaggcggcacctatgccggtaac
ccattggcggtggccgctgcgcacgccgtattggatgtgattgaagaagaacaactgtgc
cagcgggcgcagcgcctggggcaacacctggtggaattcctgcagcaggcgcgcagcacc
tgcccggcgattgttgatattcgcgctttaggttcgatggtggcggttgaatttaacgat
ccgcaaaccggcaagccttccgccgcctatactcacaaggtgcaacaaaaggcgttggaa
gagggcttgctgctgttgacctgcggcgtgaacggcaacgtgatccgcttcctgtacccg
ctgactattcctgacgaccagttcaacaaggctctgggcattctgggccgcgcgctgacc
aactga

DBGET integrated database retrieval system