KEGG   Gossypium raimondii: 105764387Help
Entry
105764387         CDS       T04129                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
gra  Gossypium raimondii
Pathway
gra00250  Alanine, aspartate and glutamate metabolism
gra00410  beta-Alanine metabolism
gra00430  Taurine and hypotaurine metabolism
gra00650  Butanoate metabolism
gra01100  Metabolic pathways
gra01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gra00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    105764387
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    105764387
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    105764387
   00430 Taurine and hypotaurine metabolism
    105764387
Enzymes [BR:gra01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     105764387
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 105764387
NCBI-ProteinID: XP_012438388
UniProt: A0A0D2RGR2
LinkDB All DBs
Position
8
AA seq 499 aa AA seqDB search
MVLSKTASETDVSVHSTFASRYVRTSLPRFKMPENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMDSINKNYVDMDEYPVTTELQNRCVNIIAHLFNAPLGESEAAVG
VGTVGSSEAIMLAGLAFKRKWQNKRKAEGKPYDKPNIVTGANVQVCWEKFARYFEVELKE
VKLREGYYVMDPVKAVEMVDENTICVAAILGSTLNGEFEDVKLLNDLLIKKNKETGWDTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRNKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGYEGYRNVMENCHENAIVLKEGLEK
TGRFNIVSKDNGVPLVAFSLKDNKRHDEFEISETLRRFGWIVPAYTMPADAQHITVLRVV
IREDFSRTLAERLVLDIQKVLHELDTLPAKVNAKLAMAEEEEAKSGTVVKKTAIETQREV
AAFWKKYVSERKINKNKIC
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggtgttatctaagacagcatctgaaactgatgtctcagttcactccacttttgcctct
cgttatgtccgaacctcactgcccaggttcaaaatgccagaaaactccataccaaaagag
gctgcgtatcagatcatcaatgatgaactgatgcttgatggcaacccaaggttgaatctt
gcctcttttgttactacatggatggagcctgaatgtgataagcttataatggactccatt
aacaagaactacgttgacatggatgaataccctgtcaccactgagcttcagaatcgttgt
gtgaacattatagcacatcttttcaacgcaccattgggagagtcagaggcagcagttggt
gtgggaacagttgggtcatcggaggcaatcatgttggctggccttgctttcaagagaaaa
tggcaaaacaagcgtaaggctgaaggcaaaccatatgacaagcccaatatcgtgactgga
gccaatgttcaggtttgctgggagaaatttgcaaggtactttgaagtggagttgaaagaa
gtgaagcttagagaagggtactatgtgatggatcctgtcaaagcagtggaaatggttgat
gaaaacaccatctgtgtagctgcaatcttgggttcaaccctcaatggagaatttgaagat
gtcaagcttctaaacgatcttttaattaaaaagaacaaagaaactggatgggatacccca
attcatgttgatgcagctagtggtggatttattgcgccatttttgtacccagaacttgag
tgggactttaggctcccccttgtgaagagtattaatgttagtgggcataaatatggtctt
gtttatgctggaattggttgggttatctggaggaacaaagaagacttgcctgaagaactc
attttccacattaactatcttggagctgatcaaccaactttcactctcaatttctctaaa
ggttctagccaagtcattgctcagtactaccaactaatccgtttgggatatgagggatac
agaaatgtgatggagaactgtcatgaaaacgccatagtccttaaagaaggattggagaaa
acagggcgttttaacatcgtgtcaaaggacaatggggttccactggtggccttctccctc
aaagacaacaagcgtcatgacgagttcgagatatcggagacgttgcgtcgcttcggttgg
atcgtgccagcctacaccatgccagccgatgcacagcacatcactgtgctccgtgttgtg
atcagggaggacttctcccgcaccttagccgagcgtctcgtccttgacatccaaaaagtg
ctccatgagctcgataccctccctgcaaaggtcaatgccaaactggctatggctgaagaa
gaggaggccaaaagtggcaccgtcgtcaagaagactgctattgagacccaaagggaagtt
gctgctttctggaagaaatatgtcagtgagagaaaaattaacaagaacaaaatttgttag

DBGET integrated database retrieval system