KEGG   Gossypium raimondii: 105782289Help
Entry
105782289         CDS       T04129                                 

Definition
(RefSeq) hexokinase-1-like
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
gra  Gossypium raimondii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gra00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105782289
   00051 Fructose and mannose metabolism
    105782289
   00052 Galactose metabolism
    105782289
   00500 Starch and sucrose metabolism
    105782289
   00520 Amino sugar and nucleotide sugar metabolism
    105782289
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    105782289
Enzymes [BR:gra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     105782289
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
13
AA seq 498 aa AA seqDB search
MGKVAVGAAAVCAAAVCAAAALVVHHRMKSSGKWAQAQSILKDFEEKCGTPISKLKQVAD
AMTVEMHAGLASEGGSKLKMIISYVDNLPTGDEKGLFYALDLGGTNFRVLRVHLGGKEHR
VVKQEFEEVSIPPHLMTGSSDALFDYIAEALAKFVATESEGLHFSPDRQRELGFTFSFPV
RQTSISSGNLIKWTKGFSIEEAVGQDVVGELTKAMERIGLDMRVTALVNDTIGTLAGGRY
NNPDVVAAVILGTGTNAAYVERAHAIPKWHGLLPKSGDMVINMEWGNFRSSHLPISEYDQ
ALDTESLNPGEQIFEKLISGMYLGEVVRRVLYKMADEAAFFGDTIPEKLKIPFILRTPHM
SAMHQDTSPDLKIVATKLKDILEISNTSLKMRKVIVELCDIVATRGARLSAAGIAGILKK
IGRDTLKDGEKQKSVVSLDGGLYEHYTKFRTCMENTLTELLGEEVSENIIIEHSNDGSGI
GAALLAASHSQYIGIDES
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggggaaagtagcggtgggtgcggcggccgtgtgtgccgcggccgtgtgtgccgcggcg
gcgttggtggtacatcaccggatgaagagttcggggaagtgggcccaggctcaatctata
ctgaaagatttcgaggaaaagtgcggcacgccgatttcgaagctgaaacaggtggcggat
gctatgaccgtcgagatgcacgccgggctcgcatcggaaggcgggagcaagcttaaaatg
atcatcagctacgtcgataatctccccactggtgatgagaaagggctgttttatgcgctt
gacctcggtggcaccaatttccgtgtgctacgtgtacacttgggtggtaaagaacaccgt
gtcgttaagcaggaattcgaggaagtatcgattcctcctcatttgatgaccggatcttct
gacgcattatttgattatattgccgaagctcttgcaaaatttgttgctacagaaagtgaa
ggtttacatttttcacccgatagacaaagggagctggggtttacgttctcatttcctgtt
cggcaaacatcgatatcctctgggaatcttataaaatggacaaagggcttctcgattgaa
gaagcagttggtcaagatgttgttggagaattgactaaagccatggaaaggattggcctc
gacatgcgtgtgacagctttggtcaatgacacaattggcacattggctggtggaagatat
aacaacccagatgttgttgctgctgtgatattgggtacaggcaccaatgcagcttatgta
gagcgtgctcatgcaattcccaaatggcacggtcttctacctaagtctggggacatggtt
atcaacatggagtggggtaacttccggtcttctcaccttccaatatcagaatatgaccaa
gcactggatactgagagcttaaaccctggagaacagattttcgagaaattgatttctggt
atgtatttgggagaggttgtacgtagagttctgtacaagatggccgatgaagccgcattt
tttggtgatactattccggaaaaactgaaaattcctttcatactaagaactcctcacatg
tccgcaatgcatcaggacacatctccggatctcaaaattgtggcgacaaaactaaaggat
atcttagagatatcgaatacctccctgaaaatgagaaaagttattgttgagctatgtgac
attgttgcaactcgtggtgcccgactatcggctgcgggaattgccggcatcctcaagaaa
atcggaagagacacattgaaagatggtgaaaagcaaaagtcggttgtgtctctagacggt
ggattgtacgaacactacaccaaattccgtacctgcatggagaacaccctcaccgagttg
ctaggagaagaagtctccgaaaacatcattatcgaacattccaacgatggttccggcatc
ggggcagccctcctagcggcttctcactcacaatacatcggaattgacgaatcctga

DBGET integrated database retrieval system