KEGG   Gossypium raimondii: 11538595Help
Entry
11538595          CDS       T04129                                 

Gene name
rbcL, A6772_cp029
Definition
(RefSeq) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
gra  Gossypium raimondii
Pathway
gra00630  Glyoxylate and dicarboxylate metabolism
gra00710  Carbon fixation in photosynthetic organisms
gra01100  Metabolic pathways
gra01200  Carbon metabolism
Module
gra_M00165  Reductive pentose phosphate cycle (Calvin cycle)
gra_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
gra_M00532  Photorespiration
gra_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:gra00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    11538595 (rbcL)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    11538595 (rbcL)
Enzymes [BR:gra01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     11538595 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-GeneID: 11538595
NCBI-ProteinID: YP_005087701
UniProt: H2B943
LinkDB All DBs
Position
CP
AA seq 479 aa AA seqDB search
MSPQTETKASVGFKAGVKEYKLTYYTPQYEVKDTDILAAFRVTPQPGVPPEEAGAAVAAE
SSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGEEDQYICYVAYPLDLFEEGSVTNMFTSI
VGNVFGFKALRALRLEDLRIPTAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGL
SAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEAIYKSQAETGEIKGHYL
NATAGTCEEMIKRAVCARELGVPIVMHDYLTGGFTANTSLARYCRDNGLLLHIHRAMHAV
IDRQKNHGMHFRVLAKALRMSGGDHIHAGTVVGKLEGERDITLGFVDLLRDDFIEKDRSR
GIYFTQDWVSMPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAVAN
RVALEACVQARNEGRDLAREGNEIIREASKWSPELAAACEVWKAIKFEFDAVDKLDKPA
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccacaaacagagactaaagcaagtgttggattcaaagctggtgttaaagagtat
aaattgacttattatactcctcaatatgaagtcaaagatactgatatcttggcagccttc
cgagtaactcctcaacccggagttccgcctgaggaagcaggggccgcggtagctgctgaa
tcttctactggtacatggacaaccgtgtggaccgatgggcttaccagccttgatcgttac
aaagggcgatgctaccacattgagcccgttcctggagaagaagatcaatatatatgttat
gtagcttaccctttagacctttttgaagaaggttctgttactaacatgtttacttccatt
gtgggtaatgtatttgggttcaaagccctgcgcgctctacgtctagaggatctgcgaatc
cctactgcttatgttaaaactttccaaggcccgcctcatggcatccaggttgaaagagat
aaattgaacaagtatggtcgccccctattaggatgtactattaaacctaaattggggtta
tccgctaagaactacggtagagcagtttatgaatgtctacgtggcgggcttgattttacc
aaagatgatgagaatgtgaactcccaaccatttatgcgctggagagaccgtttcttattt
tgtgccgaagcaatttataaatcacaggctgaaacaggtgaaatcaaagggcattacttg
aatgctactgcaggtacatgtgaagaaatgatcaaaagggccgtgtgtgctagagaattg
ggagttcctatcgtaatgcacgactacttaacaggtgggttcactgcaaatactagcttg
gctcgttattgccgagataatggtctacttcttcacatccatcgcgcaatgcacgcagtt
attgatagacagaagaatcatggtatgcactttcgtgtactagctaaagctttacgtatg
tctggtggagatcatattcacgctggtacagtagtaggtaaacttgaaggagaaagggac
ataactttgggctttgttgatttactacgtgatgattttattgaaaaagatcgaagccgt
ggtatttatttcactcaagattgggtttctatgccaggtgttctgcccgtagcttcgggg
ggtattcacgtttggcatatgcctgctttgaccgagatctttggagatgattccgtacta
caattcggtggaggaactttaggacacccttggggaaatgcaccgggtgccgtagctaat
cgagtagctttagaagcatgtgtacaagctcgtaatgagggacgtgaccttgcccgcgag
ggtaatgaaattatccgcgaggctagcaaatggagtcctgaactagctgctgcttgtgaa
gtatggaaggcgatcaaatttgaattcgacgcagtggataaattagataaaccagcttga

DBGET integrated database retrieval system