KEGG   Geoalkalibacter subterraneus: GSUB_04515Help
Entry
GSUB_04515        CDS       T03585                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gsb  Geoalkalibacter subterraneus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:gsb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GSUB_04515
   00030 Pentose phosphate pathway
    GSUB_04515
   00051 Fructose and mannose metabolism
    GSUB_04515
   00052 Galactose metabolism
    GSUB_04515
  Energy metabolism
   00680 Methane metabolism
    GSUB_04515
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    GSUB_04515
Enzymes [BR:gsb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     GSUB_04515
Protein phosphatases and associated proteins [BR:gsb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     GSUB_04515
Messenger RNA biogenesis [BR:gsb03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     GSUB_04515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1008736..1009698)
Genome map
AA seq 320 aa AA seqDB search
MKRIAVLTSGGDSSGMNAAVRAVVRSALSSGLEVVGINKGYKGLIDRNYGMMSTRSVSNI
LQRGGTFLQSARCKEMMEEAGQNLAAENLKGMGVEGLVVIGGDGSLRGALSLHRRGIKTI
GIPASIDNDIPYTSMSLGVDTALNNIVYAIDCLKDTASSHDRAFIVEIMGRNCGYLTLVA
AIACGAEHALIPETPFNIGRICENLRKRYREGRDNSIILVAEGVATAQEISNQIKDCIGF
ESRIMVLGHYQRGGSPSSFDRLLGSRFGQGAVQALMEGESGKMIGLSASKMKLTDLEKVL
TGKIRPIDKSMVQLSKSLDF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacgtattgcggtattgaccagcggcggcgacagttccggcatgaacgccgcagtg
cgcgcggtggtgcgttcggccctttcttcgggacttgaggtcgtcggtatcaacaaaggg
tataaagggctgatagaccggaactacggcatgatgagcacccgttcggtcagcaatatt
ctacagcgtggcggcacctttctgcagagtgcgcgctgcaaggagatgatggaagaggcc
ggacagaacctcgcggctgaaaacctcaaaggcatgggcgtcgaaggactggtggtcatt
gggggagacggttccctgcggggcgctctcagcctgcaccggcgcggcatcaaaacgatc
ggcatcccggcctccattgacaatgacatcccctacacatccatgtcgctgggagtcgat
acggcattgaacaacatcgtttacgccatcgactgcctcaaggataccgcatcaagtcat
gatcgtgccttcatcgtcgaaatcatggggcgcaattgtggatacctgacattggttgcg
gctattgcctgcggtgcagaacatgccctgatcccggaaacccccttcaatatcggcagg
atctgcgagaacctgcgcaaacgttaccgcgaagggcgcgacaattcgattatcctggtg
gccgagggagtcgccacggcccaggaaatttcaaatcagatcaaggactgtatcggcttc
gaatcgcgcatcatggtgctggggcattatcagcgcggcggctcgccgtcaagcttcgac
cgcctgctcggatctcgattcggccagggagcagtacaggccctgatggagggagagtcg
ggtaagatgatcggcttatctgcgtcgaagatgaaactgaccgacctggaaaaggtgctg
acaggaaagatccgtcccatcgacaaaagcatggtgcaattgtccaaatctctcgatttt
taa

DBGET integrated database retrieval system