KEGG   Geobacillus stearothermophilus: GT50_05190Help
Entry
GT50_05190        CDS       T04043                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gse  Geobacillus stearothermophilus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:gse00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GT50_05190
   00030 Pentose phosphate pathway
    GT50_05190
   00051 Fructose and mannose metabolism
    GT50_05190
   00052 Galactose metabolism
    GT50_05190
  Energy metabolism
   00680 Methane metabolism
    GT50_05190
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    GT50_05190
Enzymes [BR:gse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     GT50_05190
Protein phosphatases and associated proteins [BR:gse01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     GT50_05190
Messenger RNA biogenesis [BR:gse03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     GT50_05190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
complement(981612..982571)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAIRAVVRKAIYHGVEVYGIYHGYAGLIAGNIKKLEVGDVGDI
IHRGGTILYTARCPEFKTEEGQKKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEHGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVVEVMGRHAGDIALWS
GLAGGAETILIPEADYDMDDIIARLKRGHERGKKHSIIIVAEGVGSGVDFGRQIQEATGF
ETRVTVLGHVQRGGSPTAFDRVLASRLGARAVELLLEGKGGRCVGIQNNQIVDHDIAEAL
AKTHTVDQRMYTLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggattggtgtgttgacaagcggcggcgactcgccgggcatgaatgcggccatt
cgcgctgtcgtccgcaaagcgatttaccatggggtggaagtgtacggaatctaccacggg
tatgccgggttgatcgccggcaatatcaaaaagctggaagtcggggacgtcggggacatc
atccatcgcggcggcaccatcctttataccgcgcgctgcccggagtttaagacggaagaa
ggacagaaaaaggggatcgagcagctgaaaaagcacggcattgaagggctggtcgtcatc
ggcggcgacgggtcgtatcaaggggcgaaaaaattgacggagcacggcttcccgtgcgtc
ggcgtgcccgggacgatcgacaacgacattccaggcaccgatttcacgatcggttttgac
accgcgctcaatacggtcattgacgccattgacaaaatccgcgacacggcgacgtcgcat
gagcggacgtacgtcgtcgaagtgatgggccgccatgccggcgatattgcgctatggtcg
gggcttgccggaggggcggagacgattttgattccggaagcggactacgacatggacgac
atcatcgctcgcttgaagcgcggccatgaacgcggcaaaaaacacagcatcatcatcgtc
gccgagggagtcggcagcggcgtcgacttcggccggcaaattcaagaggcgaccggcttt
gagacgcgcgtgacggtgcttggccacgtgcagcgcggcggatcgccgacggcgtttgac
cgcgtgttagcgagccgcctcggcgcccgtgcggtcgagctgctccttgaaggcaaaggc
ggccgctgcgttggcattcaaaacaaccaaatcgttgaccatgacattgccgaagcgttg
gcgaaaacacatacggtcgatcagcggatgtatacattgtcgaaagagctgtcgatttaa

DBGET integrated database retrieval system