KEGG   Geobacillus stearothermophilus: GT50_05725Help
Entry
GT50_05725        CDS       T04043                                 

Definition
(GenBank) bacillolysin
  KO
K01400  bacillolysin [EC:3.4.24.28]
Organism
gse  Geobacillus stearothermophilus
Brite
Enzymes [BR:gse01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     GT50_05725
Peptidases [BR:gse01002]
 Metallo Peptidases
  Family M4: thermolysin family
   GT50_05725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M4_C Peptidase_M4 FTP PepSY
Motif
Other DBs
NCBI-ProteinID: ALA69775
UniProt: A0A0K2H6W8
LinkDB All DBs
Position
complement(1093424..1095064)
Genome map
AA seq 546 aa AA seqDB search
MNKRAMLGAIGLAFGLMAWPLGASAKERSMVWNEQWKTPSFVSGPLLKGEDAPEELVYRY
LDQEKNTFQLGGQARERLSLIGKQTDELGHTVMRFEQRYHGIPVYGAVLVAHVNDGELSS
LSGTLIPNLDKRTLKTEAAISVQQAEMIAKQDVADAVTKERPAAEEGKPTRLVIYPDGET
PRLAYEVNVRFLTPVPGNWIYMIDAADGNVLNKWNQMDEAKPGGGQSVAGASTVGVGRGV
LGDQKYINTTYSSYYGYYYLQDNTRGSGIFTYDGRNRTVLPGSLWADGDNQFFASYDAAA
VDAHYYAGVVYDYYKNVHGRLSYDGSNAAIHSTVHYGRGYNNAFWNGSQMVYGDGDGQTF
LPFSGGIDVVGHELTHAVTDYTAGLVYQNESGAINEAMSDIFGTLVEFYANRNPDWEIGE
DIYTPGIAGDALRSMSDPAKYGDPDHYSKRYTGTQDNGGVHTNSGIINKAAYLLSQGGVH
YGVSVTGIGRDKMGKIFYRALVYYLTPTSNFSQLRAACVQAAADLYGSTSQEVNSVKQAF
NAVGVY
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaacgggcgatgcttggcgcgattgggttggcgtttggattgatggcttggccg
ctcggggcttcagcgaaggaaagatcaatggtgtggaacgaacagtggaagacgccatcg
ttcgtttctggtccgctgttaaaaggcgaggatgctccggaagaattggtttaccgttat
cttgatcaagagaagaatacgttccagcttggtggacaagcccgcgaacggctgagcttg
attggcaaacaaacggatgaactcggccatacggtcatgcgttttgaacagcgctatcac
ggcatcccagtgtatggcgccgtgctcgttgcccatgtcaacgatggcgaattgtcctct
ttgtcgggtacgctcattccgaatttggacaaacgaacgttgaaaacagaagctgccatt
tccgttcaacaagcggaaatgatcgcgaaacaagatgtggctgatgcggtgacgaaagaa
cggccggcggccgaagagggaaaaccaacgcggcttgtcatctatccggatggggagacc
ccgcgcctcgcctatgaagtcaatgtccgctttttaacccctgtcccaggcaactggatc
tacatgatcgatgccgcggacggaaacgtgttgaacaaatggaaccaaatggacgaggcg
aagccgggcggcgggcagtcggtcgccggcgcgtcgacggtcggcgtgggccgcggtgtg
ttgggggatcagaaatatatcaatacgacgtattcctcgtattacggctactactatttg
caagacaatacgcgcggcagcggcatttttacgtatgacggacgaaaccgcaccgttttg
cccggcagcttgtgggccgatggcgacaaccaatttttcgccagctatgacgcggcggcc
gtggacgcccattattacgccggcgtcgtgtatgattactacaaaaatgtgcacggccgg
ctgagctatgacggcagcaacgccgccatccattcgaccgtccattacggccgcggctac
aacaacgcgttttggaacggttcgcaaatggtgtacggcgatggcgacggacagacgttt
ttgccgttttccggcggcattgacgtcgttgggcatgagctgacccatgcggtgacggat
tatacggccgggcttgtttaccaaaacgaatccggcgccatcaatgaagcgatgtccgat
attttcggcacgctcgtggagttctacgccaaccgcaacccggactgggagatcggcgaa
gacatttacacgcctgggatcgccggcgatgcgctccgctcgatgtccgacccggcgaaa
tacggcgatccggatcattattccaaacggtacaccggaacgcaagacaacggcggcgtc
catacaaacagcggcatcatcaataaagcggcgtatttgctcagccaaggcggcgtccat
tacggcgtgagcgtcaccggcatcggccgcgacaaaatggggaaaattttctaccgggcg
cttgtctactatttgacgccgacgtcgaacttcagccagctgcgcgccgcctgcgtgcaa
gcggccgctgatttgtacgggtcgacaagccaagaagtcaactcggtgaaacaggcgttc
aatgcggttggagtgtattaa

DBGET integrated database retrieval system