KEGG   Geobacillus stearothermophilus: GT50_07800Help
Entry
GT50_07800        CDS       T04043                                 

Definition
(GenBank) cytochrome C oxidase subunit II
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
gse  Geobacillus stearothermophilus
Pathway
gse00500  Starch and sucrose metabolism
gse01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gse00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GT50_07800
Enzymes [BR:gse01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     GT50_07800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 DUF1939
Motif
Other DBs
NCBI-ProteinID: ALA70122
UniProt: A0A0K2H7W7
LinkDB All DBs
Structure
PDB: 

Jmol
Position
1474115..1475764
Genome map
AA seq 549 aa AA seqDB search
MLTFHRIIRKGWMFLLAFLLTASLFCPTGQPAKAAPPFNGTMMQYFEWYLPDDGTLWTKV
ANEANNLSSLGITALWLPPAYKGTSRSDVGYGVYDLYDLGEFNQKGTVRTKYGTKAQYLQ
AIQAAHAAGMQVYADVVFDHKGGADGTEWVDAVEVNPSDRNQEISGTYQIQAWTKFDFPG
RGNTYSSFKWRWYHFDGVDWDESRKLSRIYKFRGIGKAWDWEVDTENGNYDYLMYADLDM
DHPEVVTELKNWGKWYVNTTNIDGFRLDAVKHIKFSFFPDWLSYVRSQTGKPLFTVGEYW
SYDINKLHNYITKTNGTMSLFDAPLHNKFYTASKSGGAFDMRTLMTNTLMKDQPTLAVTF
VDNHDTEPGQALQSWVDPWFKPLAYAFILTRQEGYPCVFYGDYYGIPQYNIPSLKSKIDP
LLIARRDYAYGTQHDYLDHSDIIGWTREGVTEKPGSGLAALITDGPGGSKWMYVGKQHAG
KVFYDLTGNRSDTVTINSDGWGEFKVNGGSVSVWVPRKTTVSTIAWPITTRPWTGEFVRW
TEPRLVAWP
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
gtgctaacgtttcaccgcatcattcgaaaaggatggatgttcctgctcgcgtttttgctc
actgcctcgctgttctgcccaacaggacagcccgccaaggctgccccaccgtttaacggc
accatgatgcagtattttgaatggtacttgccggatgatggcacgttatggaccaaagtg
gccaatgaagccaacaacttatccagccttggcatcaccgctctttggctgccgcccgct
tataaaggaacaagccgcagcgacgtagggtacggagtatacgacttgtatgacctcggc
gaattcaatcaaaaagggaccgtccgcacaaaatacggaacaaaagctcaatatcttcaa
gccattcaagccgcccacgccgctggaatgcaagtgtacgccgatgtcgtgttcgaccat
aaaggcggcgccgacggcacggaatgggtggacgccgtcgaagtcaatccgtccgaccgc
aaccaagaaatctcgggcacctatcaaatccaagcatggacgaaatttgattttcccggg
cggggcaacacctactccagctttaagtggcgctggtaccattttgacggcgttgattgg
gacgaaagccgaaaattgagccgcatttacaaattccgcggcatcggcaaagcgtgggat
tgggaagtagacacggaaaacggaaactatgactacttaatgtatgccgaccttgatatg
gatcatcccgaagtcgtgaccgagctgaaaaactgggggaaatggtatgtcaacacaacg
aacattgatgggttccggcttgatgccgtcaagcatattaagttcagtttttttcctgat
tggttgtcgtatgtgcgttctcagactggcaagccgctatttaccgtcggggaatattgg
agctatgacatcaacaagttgcacaattacattacgaaaacaaacggaacgatgtctttg
tttgatgccccgttacacaacaaattttataccgcttccaaatcagggggcgcatttgat
atgcgcacgttaatgaccaatactctcatgaaagatcaaccgacattggccgtcaccttc
gttgataatcatgacaccgaacccggccaagcgctgcagtcatgggtcgacccatggttc
aaaccgttggcttacgcctttattctaactcggcaggaaggatacccgtgcgtcttttat
ggtgactattatggcattccacaatataacattccttcgctgaaaagcaaaatcgatccg
ctcctcatcgcgcgcagggattatgcttacggaacgcaacatgattatcttgatcactcc
gacatcatcgggtggacaagggaaggcgtcactgaaaaaccaggatccggactggccgca
ctgatcaccgatgggccgggaggaagcaaatggatgtacgttggcaaacaacacgccgga
aaagtgttctatgaccttaccggcaaccggagtgacaccgtcaccatcaacagtgatgga
tggggagaattcaaagtcaatggcggttcggtttcggtttgggttcctagaaaaacgacc
gtctctaccatcgcttggccgatcacaacccgaccgtggactggtgaattcgtccgttgg
accgagccacggttggtggcatggccttga

DBGET integrated database retrieval system