KEGG   Geobacter sulfurreducens KN400: KN400_1732Help
Entry
KN400_1732        CDS       T01940                                 

Definition
(GenBank) pyridoxal-5'-phosphate-dependent decarboxylase
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
gsk  Geobacter sulfurreducens KN400
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Quorum sensing
Brite
KEGG Orthology (KO) [BR:gsk00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    KN400_1732
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KN400_1732
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KN400_1732
   00430 Taurine and hypotaurine metabolism
    KN400_1732
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    KN400_1732
Enzymes [BR:gsk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     KN400_1732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1840050..1841708
Genome map
AA seq 552 aa AA seqDB search
MPKNRDAARASLENLYRIFTVPEAPDSTLGAIDQAISGDVTGFLQTHIVAIERDLEDIEA
NFSSFSIPEEPTYVSEYTEFVKENLVAHSVHTASPAFVGHMTSALPYFMLPLARLMTALN
QNVVKVETSKAFTPMERQVLAMLHHLVYRRDEDFYPSWIHNSRHALGAFCSGGTIANITA
LWVARNRLFAPNGAFRGIAQEGLARALKHRGADGIAVLVSERGHYSLGKATDLLGIGRDD
LVKVKTDANNRIDLKALREECRRFQDRNTLPLALVGIAGTTETGNVDPLEAMADLAQELG
CHFHVDAAWGGPTLFSDRHRSLLKGIERADSVTIDGHKQLYVPMGAGMVVFKDPTALSAI
EHHANYILRHGSKDLGSHTLEGSRPGKAMLVHAGFSIIGRKGYELLIDMGIERARTFADM
IKQHPDFELISEPELNILTYRYCPAAVQQTLHDVTDRERADINALLDLVCQLLQKFQREA
GKTFVSRTRLHVARHDRELTVLRVVLANPLTTDEILESVLAEQCELVQLPEIQAVLQQVE
ELCTGLAKAASW
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaaaatcgtgacgcagctcgtgccagccttgagaacctctaccggatcttcacc
gtgcctgaagcacccgactcgaccctcggcgctatcgatcaggcgatttccggcgatgtt
accggtttcctgcagacccatatcgtcgccatcgagcgtgatctggaagatatcgaagca
aatttctcttccttctccattccggaagaaccgacctacgtttccgaatacaccgaattc
gtcaaagagaacctcgtcgcccactcggtccataccgcttcgccggcgttcgtcggtcac
atgacctcggcgctcccgtacttcatgctgccgctggcgcgtctcatgaccgccctcaac
cagaacgtggtcaaggtggagacatccaaggcctttacaccgatggaacggcaggtcctt
gccatgcttcaccacttggtctatcgccgcgacgaggacttctacccatcatggattcat
aacagccggcatgctctgggggccttttgttccggcggtaccatcgccaatattacggcc
ctgtgggtggcacgcaaccgcctgtttgccccgaacggagcatttcgcggcattgcccag
gaggggctggcccgtgcgcttaagcatcgcggcgcggacggcattgccgtgctcgtctcc
gaacgggggcactactccctgggaaaggcgaccgacctgctcggcattggccgggacgat
ctggtcaaggtgaaaaccgacgcgaacaaccgcattgacctcaaggcactgagagaagag
tgccggcgcttccaggaccggaacacgctcccgctggcactggtcggcatcgccggaacc
accgaaaccggcaacgtggaccctctggaggcgatggccgatcttgctcaggaacttggc
tgccatttccatgtggatgccgcgtggggtggaccgaccctcttttcggatcgccaccgc
tctctgcttaagggtatcgagcgagccgactcggtcaccattgacgggcataagcagctc
tatgtgccgatgggggcgggaatggtcgtcttcaaggatcccaccgccctgtcggccatc
gagcatcacgccaactatatcctgcgccacggttccaaggacctgggcagccataccctg
gagggatcacggccggggaaggcgatgttggtacatgccggtttctcgatcattggacgc
aaagggtacgaactgctgatcgacatggggatcgaacgtgctcgcacctttgccgacatg
atcaagcagcatcccgatttcgaactgatcagcgaaccggaactgaatatccttacttat
cgctactgcccggccgccgttcagcagaccttgcacgacgtgacggaccgggaacgcgcc
gatatcaatgcactcctcgatctggtctgccagttgctgcagaaattccagcgcgaagcc
gggaaaacatttgtctcccggacacggctgcatgtggcgcgccatgatcgggaactcacc
gtgctgcgcgtcgtcctggccaacccgctgacaactgacgagattctggagtccgtactg
gcggagcagtgtgaactcgtgcaactgccggagattcaggcagtgctgcagcaggtggaa
gagctctgtaccggcttggcaaaagcagcttcatggtag

DBGET integrated database retrieval system