KEGG   Galdieria sulphuraria: Gasu_24280Help
Entry
Gasu_24280        CDS       T02926                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
gsl  Galdieria sulphuraria
Pathway
gsl03030  DNA replication
gsl03410  Base excision repair
gsl03420  Nucleotide excision repair
gsl03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:gsl00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Gasu_24280
   03410 Base excision repair
    Gasu_24280
   03420 Nucleotide excision repair
    Gasu_24280
   03430 Mismatch repair
    Gasu_24280
Enzymes [BR:gsl01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Gasu_24280
    6.5.1.6  DNA ligase (ATP or NAD+)
     Gasu_24280
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Gasu_24280
DNA replication proteins [BR:gsl03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Gasu_24280
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Gasu_24280
DNA repair and recombination proteins [BR:gsl03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Gasu_24280
   NER (nucleotide excision repair)
    Other NER factors
     Gasu_24280
   MMR (mismatch exicision repair)
    Other MMR factors
     Gasu_24280
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 17089018
NCBI-ProteinID: XP_005706800
UniProt: M2X1Q8
LinkDB All DBs
Position
Unknown
AA seq 741 aa AA seqDB search
MRTRLCFLIPSVHKIFYVQRASLTMKRKASNISPRKQPSTIPKSSIGSYLSILQKEEPSS
LDTERQAKENVDQNTNDMRLESQQGSETSSSTSEHSSSLVENAKVVCEEKLDECTFSSVS
WQPPSRTPFRFLAEAFEVMEMTTSRLALIKILTQVFRKIVNTTPDDLLPCVYLCTNMLGP
AHEGLELKAGEATVLNALSSATGNSVKVLKERLIKLGDIGDLAAECRTTQQTMFKPPSLT
IQGVYQEFRTMANLAGKMSTKEREKHLQKLLVSATSQEAKYIARIVLGKLRIHIAYKTVI
ASLATVFAPCSKTVGKTADEMDSIVKEATATLNAVYSQLPMWDRIIPVLIQNKSTQGLED
HCRLTPGVPVGPMLAKPAKEASDVLERFQECSFVCEYKYDGMRAQIHYLPDGNVKIFSRN
AEDDTPKYPDIVENIKFALSKNKAVRSFIIDSEVVAYDPETNVMKSFQELQGRARKEVKL
EDIKVSVCVFAFDILFFNGESLLKWSLKERREKLIETFSPVQGKFQFTTSKVFTDWEGVD
EMMDEAIQAGCEGLMIKALTGEYSSYEPSNRSQNWLKMKKDYMNSIGDSLDLVPIGAYYG
RGKRSGVFGAFLLACYNSETEEFQTVCKLGTGFSDEFLSSITKFYKDGHILAEPKPYYGV
SDSPTIIPDVWFDPCQVWETRCADLTLSPSHTAAKGMLSEEDKGIALRFPRFIRIREDKS
VDDATTAEQIVELYSNQKSKM
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgagaactcgcctatgttttcttattccttcggttcacaaaatattttatgttcagcgt
gctagtttaactatgaaaaggaaagcttcaaacatttcaccaaggaaacaaccgtcaaca
atacccaagtcctctatcggctcttacctttcaatcttgcaaaaagaggagccgtcgtcg
ttagacactgaaagacaagcaaaggagaatgtggaccagaataccaacgatatgcgactt
gaaagccagcaaggttccgagacgagttccagtacttcggaacattcttcttctcttgta
gaaaatgccaaggttgtatgtgaagagaaactcgatgaatgtaccttctccagtgtcagt
tggcaacctccttctagaacgccttttcgttttttagcagaggcctttgaagtgatggaa
atgacaacttcacgattggcactcatcaaaatacttacgcaggtctttcgcaagattgtc
aatactactccagacgatcttttaccttgtgtctatctttgtaccaatatgttgggacca
gctcacgagggtttggaattgaaggcgggagaagctacagtacttaatgctctttcctct
gccactgggaactccgtgaaagttttaaaggaacgattgataaaacttggtgatatcggt
gacttagcagcagaatgtagaacaactcagcaaaccatgttcaagccacctagcttaact
atacaaggtgtttaccaggagtttcgcacgatggccaatcttgcaggtaaaatgtctacc
aaggaaagagagaaacatttgcaaaagttattagtaagtgctactagtcaagaagccaag
tatatagctaggattgttttgggaaagctgcgcattcatattgcgtacaagacagtcatt
gcgtcgctagctacagtctttgctccttgttctaaaacagttggaaaaacagcggatgaa
atggatagtatagtaaaggaggctactgcaactctgaacgctgtctattctcagttgcca
atgtgggatcgtatcataccagtcttaatacaaaataaaagcactcaaggattagaagat
cattgcaggttgactccaggagttccggttggtccaatgcttgcaaagcctgcaaaggaa
gcatctgatgtgcttgagagatttcaagagtgttcttttgtttgtgagtacaaatatgat
ggaatgcgagctcagatacattatctgccggatggaaatgtgaaaatcttttcaagaaat
gcagaagatgatactccgaaatatcctgacattgtggaaaacatcaagtttgctctgtcc
aaaaataaggcagtaagatcatttataatagactcggaagtcgttgcatacgatcctgaa
acaaatgtcatgaaaagctttcaggagttacaaggtcgcgcgagaaaggaagtgaaactt
gaagatattaaggtatctgtttgtgtgtttgcatttgatatcttatttttcaatggagag
tctttattaaagtggagtctgaaggaacgtcgggaaaaactcattgaaactttctctcct
gttcaaggaaaatttcagtttacaacatcgaaagtgttcactgattgggaaggtgttgac
gaaatgatggatgaagctattcaagcaggttgtgaaggcctgatgatcaaagcattaaca
ggagaatattcgtcttatgagccttctaatcgatctcaaaactggctgaaaatgaagaaa
gactatatgaactctattggggatagcctagacttagtaccgattggagcctattatggg
agaggaaagcggtcaggcgtgtttggtgcatttttacttgcatgttacaactcagaaaca
gaagagtttcaaaccgtttgcaagttgggtacagggtttagcgacgaatttttgagttct
attacaaagttttataaagatggtcacattttggcggagcctaagccttattatggagtt
tcggatagtcctactattatacctgatgtatggtttgacccatgtcaggtttgggaaaca
aggtgtgcagatttaaccctatctccctcccatacggcagcaaaaggtatgttgtccgaa
gaagataaaggaatagcactccgattcccacgtttcattcgaatcagagaagataagtca
gttgacgatgcgacaacagcagagcaaatagttgaactgtattctaaccaaaaaagtaaa
atgtga

DBGET integrated database retrieval system