KEGG   Geobacillus subterraneus: GS3922_01530Help
Entry
GS3922_01530      CDS       T04323                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
gsr  Geobacillus subterraneus
Brite
Enzymes [BR:gsr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     GS3922_01530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu LPAM_2 Lipase_bact_N
Motif
Other DBs
NCBI-ProteinID: AMX82472
UniProt: A0A146CPD1
LinkDB All DBs
Position
329802..330326
Genome map
AA seq 174 aa AA seqDB search
MLYGKYGILLAAALMLAGCGQEDGTSRTVEMINADSDPIGTIELTEQAEGVRLKLDLEGL
PPGERAIHIHEKGSCEPPDFQSAGGHYNPDGKKHGLLHPEGAHAGDLPNIIVKDDGTVNV
ELTAPNVTLREGEKGSLLTKDGTSIVIHAKKDDGMTQPAGDAGGRIACGEIKSS
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
gtgttgtacggaaaatatgggatccttttggctgcggcgctcatgttagcgggctgcggc
caagaggacggcacgagccggacggtggagatgatcaatgcggacagcgatccgattggc
accattgagttgacggaacaggcggaaggggttcggttgaaactcgacctagaagggctt
ccgccgggagagcgtgccattcatattcatgaaaaagggagctgcgaaccgcccgatttt
caatcggccggcgggcattacaatcccgatgggaaaaagcacgggcttctccacccggaa
ggcgcgcatgccggtgatttgccgaacattattgtcaaagacgacggcacggtcaacgtt
gaactgacggcgccaaacgtgacgttacgggaaggggaaaaagggtcactgctgacaaaa
gacggaacgtcgatcgtcattcatgcgaagaaggacgacggcatgacccaaccggcgggg
gatgcgggcggacgcatcgcctgtggggaaattaaatcatcgtaa

DBGET integrated database retrieval system