KEGG   Geobacillus subterraneus: GS3922_03840Help
Entry
GS3922_03840      CDS       T04323                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
gsr  Geobacillus subterraneus
Brite
Enzymes [BR:gsr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     GS3922_03840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
794199..794813
Genome map
AA seq 204 aa AA seqDB search
MPFELPALPYAYDALEPHIDKETMNIHHTKHHNTYVTNLNAALEGHADLQNKSLEELLSN
LEVLPESIRTAVRNNGGGHANHSLFWTILSPNGGGEPTGELAEAINQKFGSFAAFKDEFS
KAAAGRFGSGWAWLVVNNGELEITSTPNQDSPIMEGKTPILGLDVWEHAYYLKYQNRRPE
YIAAFWNVVNWDEVAKRYSEAKAK
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgccatttgaactgccggcattgccgtatgcgtacgatgcgctcgagccgcatatcgac
aaagaaacgatgaacatccaccacacgaagcaccataacacatacgtgacgaacttaaat
gcggcgcttgaagggcatgctgatttgcaaaacaagtcgttggaagagttgctcagcaat
ttggaagtccttccggaaagcattcgcaccgcagtgcgcaacaacggcggcggccatgcg
aaccattcgctcttctggacgattttatcgccaaacggcggcggcgaaccgacaggtgag
ctggctgaagcgatcaaccaaaaattcggcagctttgcggcgtttaaagacgagttttcg
aaagcagccgctggccgtttcggctccggctgggcgtggcttgtcgtcaacaacggcgag
ctggaaattacgagcacgccgaaccaagactcgccaatcatggaaggcaaaacgccgatc
cttggcttggacgtttgggagcatgcgtactacttgaaataccaaaaccgccgtccggaa
tacattgcggcgttctggaacgtcgtcaactgggatgaagtcgcgaaacgatacagtgaa
gcaaaagcaaaataa

DBGET integrated database retrieval system