KEGG   Geobacillus subterraneus: GS3922_12375Help
Entry
GS3922_12375      CDS       T04323                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
gsr  Geobacillus subterraneus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gsr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GS3922_12375
  Lipid metabolism
   00071 Fatty acid degradation
    GS3922_12375
  Amino acid metabolism
   00350 Tyrosine metabolism
    GS3922_12375
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GS3922_12375
   00626 Naphthalene degradation
    GS3922_12375
Enzymes [BR:gsr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     GS3922_12375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2535060..2536079
Genome map
AA seq 339 aa AA seqDB search
MKAAVVEQFKEPLKIKEVKKPTISYGEVLVRIKACGVCHTDLHAAHGDWPVKPKLPLIPG
HEGVGIIEEVGPGVTHLKVGDRVGIPWLYSACGHCEYCLSGQETLCEHQENAGYSVDGGY
AEYCRAAADYVVKIPDNLSFEEAAPIFCAGVTTYKALKVTGTKPGEWVAIYGIGGLGHVA
VQYAKAMGLNVVAVDIGDEKLKLAKELGADLVVNPMKEDATQFMKEKVGGVHAAVVTAVS
KPAFKSAYNSIRRGGTCVLVGLPPEEMPIPIFDTVLNGIKIIGSIVGTRKDLQEALQFAA
EGKVKTIIEMQPLEKINEVFDRMLKGEINGRVVLTLEDQ
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctgtagtggaacaatttaaggaaccattaaaaataaaagaggtgaaaaaa
ccaaccatttcatatggagaagtattagtccgcattaaagcatgcggtgtatgccatacg
gacttgcatgccgctcacggtgattggccagtaaaaccaaaactccctttaatccccgga
catgaaggagttgggattatcgaagaagtaggtccgggcgtaacccatttaaaagtgggg
gatcgcgttggaattccttggttatattctgcttgcggacattgtgaatattgtttaagc
ggacaagaaacattatgcgagcaccaagaaaacgctggctactcagtcgatggggggtat
gcagaatattgtagagctgcggcagactatgtggtcaaaattcctgacaacttatcgttt
gaagaagctgctccaattttctgtgccggagttactacctataaagcgttaaaagtaaca
ggtacaaaacctggagaatgggtagcgatctacggtatcggcggccttgggcacgttgcc
gttcaatacgctaaagcgatgggacttaatgtcgttgcagtggatatcggcgatgaaaaa
cttaaacttgcaaaagagcttggcgctgatcttgttgtaaaccctatgaaagaagatgcg
acgcaatttatgaaagagaaagttggcggagttcacgcggcagttgtaacagctgtatct
aaaccagcctttaaatctgcgtacaattctattcgcagaggcggtacgtgcgttcttgtc
ggattgccgccggaagaaatgcctattccaatttttgataccgtactaaacggaattaaa
attattggctctattgtcggtacacggaaggacttgcaagaagctctccaattcgctgcg
gaaggtaaagtaaaaaccattattgaaatgcaacctcttgaaaaaattaatgaagtattt
gacagaatgctaaaaggtgaaattaacggacgggttgttttaacgttagaagatcaataa

DBGET integrated database retrieval system