KEGG   Geobacillus thermoleovorans CCB_US3_UF5: GTCCBUS3UF5_1190Help
Entry
GTCCBUS3UF5_1190  CDS       T01676                                 

Definition
(GenBank) Elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
gte  Geobacillus thermoleovorans CCB_US3_UF5
Brite
Translation factors [BR:gte03012]
 Eukaryotic Type
  Elongation factors
   GTCCBUS3UF5_1190
 Prokaryotic Type
   GTCCBUS3UF5_1190
Mitochondrial biogenesis [BR:gte03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    GTCCBUS3UF5_1190
Exosome [BR:gte04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   GTCCBUS3UF5_1190
  Exosomal proteins of breast cancer cells
   GTCCBUS3UF5_1190
  Exosomal proteins of colorectal cancer cells
   GTCCBUS3UF5_1190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
127462..128649
Genome map
AA seq 395 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITTVLAKQGKAEAKAYDQIDAAPEERERG
ITISTAHVEYETDARHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLSEYDFPGDEVPVIKGSALKALE
GDPQWEEKIIELMNAVDEYIPTPQREVDKPFMMPIEDVFSITGRGTVATGRVERGTLKVG
DPVEIIGLSDEPKTTTVTGVEMFRKLLDQAEAGDNIGALLRGVSRDEVERGQVLAKPGSI
TPHTKFKAQVYVLTKEEGGRHTPFFSNYRPQFYFRTTDVTGIITLPEGVEMVMPGDNVEM
TVELIAPIAIEEGTKFSIREGGRTVGAGSVSEIIE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagcgaaatttgagcgcacgaaaccgcacgtcaacattggcacgatcggccac
gttgaccacgggaaaacgacgttgacagctgcgatcacgacggttttggcgaaacaaggg
aaagccgaagcaaaagcgtacgaccaaatcgacgctgctccggaagagcgtgaacgcggg
attacgatttcgacggcgcacgtcgagtatgaaacagatgctcgccactatgcgcacgtt
gactgcccgggccacgctgactacgtcaaaaacatgatcacgggcgcggcgcaaatggac
ggcgcgatccttgttgtctcggcggctgacggtccgatgccgcaaacgcgcgaacacatt
cttctctcccgccaagtcggtgttccgtacatcgttgtattcttgaacaaatgcgacatg
gtggacgacgaagaattgcttgaacttgttgaaatggaagttcgcgatcttctctctgaa
tacgacttcccaggcgatgaagtgccggtcatcaaaggttcggcattaaaagcgcttgaa
ggcgacccgcaatgggaagaaaaaatcattgaactgatgaatgcggttgacgaatacatc
ccgacgccgcaacgtgaagtggacaaaccgttcatgatgccaatcgaggacgtcttctcg
atcacgggccgcggtacggttgcaacaggccgtgttgaacgcggtacgttgaaagttggc
gacccggttgaaatcatcggtttgtcggatgagccgaaaacgacgaccgttacgggtgta
gaaatgttccgcaaacttctcgatcaagcggaagctggcgacaacatcggtgcgcttctc
cgcggcgtatctcgtgatgaagtcgagcgcggccaagtattggcgaaacctggttcgatc
acgccgcacacgaaattcaaagcgcaagtatacgtcctgacgaaagaagaaggcggacgc
catactccgttcttctcgaactaccgtccgcaattctacttccgtacgacggacgtaacg
ggcattatcacgcttccggaaggcgtcgaaatggttatgcctggcgacaacgttgaaatg
acggtggaactgatcgccccgatcgcgatcgaagaaggtacgaaattctcaatccgcgaa
ggcggccgtacggtcggcgctggctctgtatcggaaatcatcgagtaa

DBGET integrated database retrieval system