KEGG   Geobacillus thermoleovorans CCB_US3_UF5: GTCCBUS3UF5_27730Help
Entry
GTCCBUS3UF5_27730 CDS       T01676                                 

Definition
(GenBank) Superoxide dismutase [Mn] 1
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
gte  Geobacillus thermoleovorans CCB_US3_UF5
Brite
Enzymes [BR:gte01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     GTCCBUS3UF5_27730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2541162..2541776)
Genome map
AA seq 204 aa AA seqDB search
MPFELPALPYPYDALEPHIDKETMNIHHTKHHNTYVTNLNAALEGHPDLQNKSLEELLSN
LEALPESIRTAVRNNGGGHANHSLFWTILSPNGGGEPTGELAEAINKKFGSFTAFKDEFS
KAAAGRFGSGWAWLVVNNGELEITSTPNQDSPIMEGKTPILGLDVWEHAYYLKYQNRRPE
YIAAFWNIVNWDEVAKRYSEAKAK
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgccatttgaattgccagcattgccgtatccgtatgatgcgcttgagccgcacatcgac
aaagaaacgatgaacattcaccacacgaagcaccataacacatacgttacaaatttgaat
gcggcgcttgaagggcatccggatttgcaaaacaaatcgctcgaagaattgctcagcaat
ttggaagcccttccggaaagcattcgcacggcggtgcgcaacaacggcggcggtcatgca
aaccactcgcttttctggacgattttgtcgccaaatggcggcggtgagccgacgggtgag
ctggctgaggcgatcaacaaaaaattcggcagcttcaccgcgtttaaagacgagttttcg
aaagcagcggctggccgtttcggttctggctgggcatggcttgtcgtgaacaacggcgag
ctggaaattacgagcacgccgaaccaagactcgccgatcatggaaggcaaaacgccgatt
ctcggcttggacgtttgggagcatgcgtactacttgaaataccaaaaccgccgtccggaa
tacattgccgcattctggaacattgtcaactgggacgaagtggcgaaacggtacagcgaa
gcgaaagcgaagtaa

DBGET integrated database retrieval system